DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and Amy-d

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster


Alignment Length:483 Identity:90/483 - (18%)
Similarity:149/483 - (30%) Gaps:188/483 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GITSVWLSPIYESPMVDF-----GYDISNYTNIQPEYGTLEDFDALIAKANELGVKVILDFVPNH 131
            |...|.:||:.|:.:.|.     .|...:| .::...|..|.|.:::.:.|.:||:..:|.|.||
  Fly    54 GYAGVQVSPVNENAVKDSRPWWERYQPISY-KLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNH 117

  Fly   132 -----------SSNKHPWFIKSVAREPGYE----DFYVWEDGILLENGTRVPPNNWLSVFSGSAW 181
                       .|...|    |....||..    ||               .|...:|.::.:..
  Fly   118 MAADGGTYGTGGSTASP----SSKSYPGVPYSSLDF---------------NPTCAISNYNDANE 163

  Fly   182 MWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIYEDAQLRDEP 246
            :.|.|         ..|..|||..|..|...:.:.:...::.|:||||:||..:::         
  Fly   164 VRNCE---------LVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMW--------- 210

  Fly   247 PSGTTDDPNNEAYLSHIYTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEGYASVSQ--LME 309
                      .|.|:.||.|               |.|...:|          |:||.|:  :::
  Fly   211 ----------PADLAVIYGR---------------LKNLNTDH----------GFASGSKAYIVQ 240

  Fly   310 YYEDSNG--VQGPQFPFNFDFITELNANST------AADFVFYISRW------------LIYMPH 354
            ...|..|  :...::. ....|||...:.:      ..|.:.|::.|            |::   
  Fly   241 EVIDMGGEAISKSEYT-GLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLVF--- 301

  Fly   355 GHVANWVMGNHDN----------------------------------PRVASRF-------GEKS 378
                   :.||||                                  |||.|.|       |..:
  Fly   302 -------VDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPT 359

  Fly   379 VDAMNMLLMTLPGIGITYNG---EELGMTDYRDISWSDTVDQPACEAGIDNYKTISRDPERTPMQ 440
            .|..|:.............|   |......|..:::.:.|       |:|..:.          .
  Fly   360 TDGHNIASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNAV-------GLDEIQN----------W 407

  Fly   441 WSSDVN-AGFSSADRTWLPVNPNYKELN 467
            |.|..| ..||...|.::..|.:..:||
  Fly   408 WDSGSNQISFSRGSRGFVAFNNDNYDLN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 90/483 (19%)
trehalose_treC 33..538 CDD:274115 90/483 (19%)
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 78/428 (18%)
Alpha-amylase 54..342 CDD:278554 67/371 (18%)
Aamy_C 405..493 CDD:214749 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443605
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.