DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and Amyrel

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster


Alignment Length:523 Identity:111/523 - (21%)
Similarity:185/523 - (35%) Gaps:151/523 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIAFILSVGLVGILAHKHQSKELDAKYN--WW-QHEVFYQIYPRSFQDSNGDGIGDLQGITSRLQ 66
            |.|..|::.|.|.|:.        |::|  || .......::...:.|           |....:
  Fly     3 KFALTLTLCLAGSLSL--------AQHNPHWWGNRNTIVHLFEWKWSD-----------IAQECE 48

  Fly    67 YF-KDTGITSVWLSPIYESPMVDFG------YDISNYTNIQPEYGTLEDFDALIAKANELGVKVI 124
            .| ...|...|.:||:.|: ::..|      |...:| .:....|..|:|..::.:.|::||::.
  Fly    49 SFLGPRGFAGVQVSPVNEN-ILSAGRPWWERYQPISY-KLTTRSGNEEEFGDMVRRCNDVGVRIY 111

  Fly   125 LDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILLEN-GTRVPPNNWLSVFSGSAWM------ 182
            :|.:.||.|.                ||    ||:.:.. ||...|:.  ..|.|..:.      
  Fly   112 VDVLLNHMSG----------------DF----DGVAVGTAGTEAEPSK--KSFPGVPYTAQDFHP 154

  Fly   183 ------WND--ERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIYED 239
                  |||  :.||..|    .|..||:..:..|...:.:.:...:..|:||||:||..::   
  Fly   155 TCEITDWNDRFQVQQCEL----VGLKDLDQSSDWVRSKLIEFLDHLIELGVAGFRVDAAKHM--- 212

  Fly   240 AQLRDEPPSGTTDDPNNEAYLSHIYT--RNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEGYA 302
                      .::|      |.:||:  .|...|:|...:.|..:.....:|          |:.
  Fly   213 ----------ASED------LEYIYSSLSNLNIDHGFPHNSRPFIFQEVIDH----------GHE 251

  Fly   303 SVSQLMEYYEDSNGVQGPQFPFNFDFITELNANSTAADFVFYISRWLI-------YMPHGHVANW 360
            :||:  :.|:|...|  .:|.|:.:.......|:..        :||.       ::|.|....:
  Fly   252 TVSR--DEYKDLGAV--TEFRFSEEIGNAFRGNNAL--------KWLQSWGTDWGFLPSGQALTF 304

  Fly   361 VMGNHDNPRVASR-FGEKSVDAMNMLL---MTLPGIGITYNGEELGMTDY----------RDISW 411
            | .||||.|.|.. ...||.....|..   :..| .||:.........|:          |.||.
  Fly   305 V-DNHDNQRDAGAVLNYKSPRQYKMATAFHLAYP-YGISRVMSSFAFDDHDTPPPQDAQERIISP 367

  Fly   412 SDTVDQPACEAG------------IDNYKTISRDPERTPMQWSSDVNAGFSSADRTWLPVNPNYK 464
            ....| .||..|            :..:|...||.|.|....:.|....|...::.:|.:|.|..
  Fly   368 EFDAD-GACVNGWICEHRWRQIYAMVGFKNAVRDTEITGWWDNGDNQISFCRGNKGFLAINNNLY 431

  Fly   465 ELN 467
            :|:
  Fly   432 DLS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 104/498 (21%)
trehalose_treC 33..538 CDD:274115 103/493 (21%)
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 91/451 (20%)
Aamy_C 404..492 CDD:214749 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.