DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and CG10949

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:266 Identity:50/266 - (18%)
Similarity:89/266 - (33%) Gaps:89/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 WNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLF--WLNKGIAGFRIDAIIYIYEDAQLRDE 245
            |...|.::. |:|...|  :|...|...:..:|::..  ...||:.        .:.|:.:.|..
  Fly   188 WKKLRDRFG-REFRSHQ--INQSTPITWRYFNDLLFLGRHFRKGVP--------LVLENIKRRGR 241

  Fly   246 P-----PSGTT--------------------------DDPNNEAYLSHIYTRNQPEDYGLLQHWR 279
            |     |||.|                          ||..::..|::      .|:..:|....
  Fly   242 PPKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAY------DEEIEILSEAE 300

  Fly   280 Q------LLDNYTANHD--GPLRIMMT--------EGYASVSQLMEYYEDSNGVQGPQFP---FN 325
            |      :|...||..|  .|.::.:|        |...:::::....|:|:.:.|...|   .:
  Fly   301 QATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAIS 365

  Fly   326 FDFITELNANSTAADFVFYISRWLIYMPHGHVANWVMGNHDNPRVASRFGEKSVDAMNMLL---- 386
            ...:|.:.||   .:.|...||.|....|          |:..:...   ::|....|.||    
  Fly   366 DKLLTTVIAN---METVLQQSRELQAQIH----------HEQEQERE---QRSTQPANSLLAKAQ 414

  Fly   387 MTLPGI 392
            |.|.|:
  Fly   415 MLLDGL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 50/266 (19%)
trehalose_treC 33..538 CDD:274115 50/266 (19%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.