DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and AMY2A

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_000690.1 Gene:AMY2A / 279 HGNCID:477 Length:511 Species:Homo sapiens


Alignment Length:391 Identity:78/391 - (19%)
Similarity:125/391 - (31%) Gaps:140/391 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QYFKDTGITSVWLSPIYESPMVDFGYDISNYTNIQPEY--------------GTLEDFDALIAKA 116
            :|....|...|.:||..|        :::.|...:|.:              |..::|..::.:.
Human    45 RYLAPKGFGGVQVSPPNE--------NVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRC 101

  Fly   117 NELGVKVILDFVPNH----------SSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNN 171
            |.:||::.:|.|.||          ||....:|      .||..||            ..||.:.
Human   102 NNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYF------NPGSRDF------------PAVPYSG 148

  Fly   172 W------LSVFSGSAWMWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRI 230
            |      ....||....:||..|....|  ..|..||......|...:.:.|...::.|:||||:
Human   149 WDFNDGKCKTGSGDIENYNDATQVRDCR--LTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRL 211

  Fly   231 D-----------AII-----------------YIYEDA-QLRDEP-------PSGTTDDPNNEAY 259
            |           ||:                 :||::. .|..||       .:|...:....|.
Human   212 DASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAK 276

  Fly   260 LSHI----------YTRNQPEDYGLLQHWRQLLDNYTANHDG----------------------P 292
            |..:          |.:|..|.:|.:...|.|:  :..|||.                      .
Human   277 LGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALV--FVDNHDNQRGHGAGGASILTFWDARLYKMA 339

  Fly   293 LRIMMTEGYASVSQLMEY-----YEDSNGVQ---GPQFPFNFDFITE--LNANSTAADFVFYISR 347
            :..|:...|.....:..|     :::.|.|.   ||  |.|...|.|  :|.::|..:......|
Human   340 VGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGP--PNNNGVIKEVTINPDTTCGNDWVCEHR 402

  Fly   348 W 348
            |
Human   403 W 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 78/391 (20%)
trehalose_treC 33..538 CDD:274115 78/391 (20%)
AMY2ANP_000690.1 AmyAc_bac_euk_AmyA 25..416 CDD:200456 78/391 (20%)
Aamy_C 422..510 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.