DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and AMY1C

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001008220.1 Gene:AMY1C / 278 HGNCID:476 Length:511 Species:Homo sapiens


Alignment Length:382 Identity:81/382 - (21%)
Similarity:128/382 - (33%) Gaps:127/382 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QYFKDTGITSVWLSPIYESPMVDFGYDISN-----YTNIQP-------EYGTLEDFDALIAKANE 118
            :|....|...|.:||..|:      ..|.|     :...||       ..|..::|..::.:.|.
Human    45 RYLAPKGFGGVQVSPPNEN------VAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNN 103

  Fly   119 LGVKVILDFVPNH----------SSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNW- 172
            :||::.:|.|.||          ||....:|      .||..||            ..||.:.| 
Human   104 VGVRIYVDAVINHMCGNAVSAGTSSTCGSYF------NPGSRDF------------PAVPYSGWD 150

  Fly   173 -----LSVFSGSAWMWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRID- 231
                 ....||....:||..|....|  ..|..||......|...:.:.|...::.|:|||||| 
Human   151 FNDGKCKTGSGDIENYNDATQVRDCR--LSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDA 213

  Fly   232 ----------AII-----------------YIYEDA-QLRDEP-------PSGTTDDPNNEAYLS 261
                      ||:                 :||::. .|..||       .:|...:....|.|.
Human   214 SKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLG 278

  Fly   262 HI----------YTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEGY-ASVSQLMEYYEDSN 315
            .:          |.:|..|.:|.:...|.|:  :..|||.      ..|: |..:.::.:::...
Human   279 TVIRKWNGEKMSYLKNWGEGWGFMPSDRALV--FVDNHDN------QRGHGAGGASILTFWDARL 335

  Fly   316 GVQGPQF----PFNFDFITELNANSTAADFVFYISRWLIYMPHG-HVANWVMGNHDN 367
            ......|    |:.|   |.:.::          .||..|..:| .|.:||...:||
Human   336 YKMAVGFMLAHPYGF---TRVMSS----------YRWPRYFENGKDVNDWVGPPNDN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 81/382 (21%)
trehalose_treC 33..538 CDD:274115 81/382 (21%)
AMY1CNP_001008220.1 AmyAc_bac_euk_AmyA 25..416 CDD:200456 81/382 (21%)
Aamy_C 422..510 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.