DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and C50B6.7

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_506303.1 Gene:C50B6.7 / 179813 WormBaseID:WBGene00008220 Length:713 Species:Caenorhabditis elegans


Alignment Length:435 Identity:87/435 - (20%)
Similarity:140/435 - (32%) Gaps:192/435 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQYFKDTGITSVWLSPIYESPMVDF-GYDISNY---TNIQP-------EYGTLEDFDALIAKANE 118
            |||:   |..:|.:||    ||... .:..:||   ...||       ..|..::|..::.:.|:
 Worm    53 LQYY---GYGAVQVSP----PMEHLKAFPNNNYPWWVRYQPVSYKLDSRSGNEQEFQDMVNRCNK 110

  Fly   119 LGVKVILDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNNWLSVFSGSAWMW 183
            :||::|:|.|.||        :..:.::.|              ||.   .::..|.|.|:..:.
 Worm   111 VGVRIIVDIVMNH--------MVGIGQKSG--------------NGV---GSSGSSSFDGTHGVQ 150

  Fly   184 NDERQQYYLRQFT-------------------------YGQPDLNYRNPAVIKAMDDVMLFWLNK 223
            :.....|.|..|.                         .|..|||..: |.::|.   ::.:|||
 Worm   151 SFPGVPYSLGDFNNPKCDGDIQGSDYQNSAEHVKDCRLVGLLDLNQAS-ATVRAK---IVAYLNK 211

  Fly   224 ----GIAGFRIDA--------IIYIYEDAQ-LR------DEPPSGTTD--DPNNEA--------- 258
                |:||||.||        |:.|..|.: ||      ::.|....:  |...||         
 Worm   212 LVDMGVAGFRHDASKHMWPQDILNILNDVKDLRSDIYGSNQRPFAVHEVIDRGGEAVKCGDYFGN 276

  Fly   259 -----------------------YLSHI---YTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMM 297
                                   ||:::   |.....||:.:|        |:..|||       
 Worm   277 GRYTNFNFGAAVSAAAKQQSDWKYLANLGPGYGYGNNEDHDVL--------NFIDNHD------- 326

  Fly   298 TEGYASVSQLMEYYEDSNGVQGPQFPFNFDFITELNANSTAADFVFYISRWLIYMPHGHVANWVM 362
              .....|..:..|:|     |.::.....|                    ::..|:|:      
 Worm   327 --NQRDSSPYVVTYKD-----GQKYNLAVGF--------------------MLAWPYGY------ 358

  Fly   363 GNHDNPRVASRFGEKSVD-------AMNMLLMTLPGIGITYNGEE 400
                 |||.|.|.....|       |.|....|.|    |:||::
 Worm   359 -----PRVMSSFAFSYSDQSPPNSGASNDYATTSP----TFNGDQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 87/435 (20%)
trehalose_treC 33..538 CDD:274115 87/435 (20%)
C50B6.7NP_506303.1 AmyAc_bac_euk_AmyA 31..421 CDD:200456 87/435 (20%)
AmyA 53..>354 CDD:223443 72/378 (19%)
Aamy_C 432..511 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.