DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and Amy1

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001103975.1 Gene:Amy1 / 11722 MGIID:88019 Length:511 Species:Mus musculus


Alignment Length:523 Identity:104/523 - (19%)
Similarity:163/523 - (31%) Gaps:181/523 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QYFKDTGITSVWLSPIYESPMVDF-------GYDISNYTNIQPEYGTLEDFDALIAKANELGVKV 123
            :|....|...|.:||..|:.:|..       .|...:| .|....|..::|..::.:.|.:||::
Mouse    45 RYLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISY-KICSRSGNEDEFRDMVNRCNNVGVRI 108

  Fly   124 ILDFVPNH----------SSNKHPWFIKSVAREPGYEDF-------YVWEDGILLENGTRVPPNN 171
            .:|.|.||          ||....:|      .|...||       :.:.||             
Mouse   109 YVDAVINHMCGVGAQAGQSSTCGSYF------NPNNRDFPGVPYSGFDFNDG------------- 154

  Fly   172 WLSVFSGSAWMWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYI 236
            .....||....:.|..|....|  ..|..||......|...:.|.|...::.|:||||:||..::
Mouse   155 KCRTASGGIENYQDAAQVRDCR--LSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHM 217

  Fly   237 Y-----------------------------EDAQLRDEPPS-------GTTDDPNNEAYLSHI-- 263
            :                             |...|..|..|       |...:....|.|..:  
Mouse   218 WPGDIKAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVMR 282

  Fly   264 --------YTRNQPEDYGLLQHWRQLLDNYTANHDG----------------------PLRIMMT 298
                    |.:|..|.:||:...|.|:  :..|||.                      .:..|:.
Mouse   283 KWDGEKMSYLKNWGEGWGLMPSDRALV--FVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLA 345

  Fly   299 EGYASVSQLMEYY--------EDSNGVQGPQFPFNFDFITE--LNANSTAADFVFYISRW----- 348
            ..|.....:..||        :|.|...||  |.|.....|  :|.:||..:......||     
Mouse   346 HPYGFTRVMSSYYWPRNFQNGKDVNDWVGP--PNNNGKTKEVSINPDSTCGNDWICEHRWRQIRN 408

  Fly   349 ---LIYMPHGH-VANWVMGNHDNPRVASRFGEKSVDAMNMLLMTLPGIGITYNGEELGMTD---- 405
               ...:.:|. .|||  .::|:.:||...|.|..              |.:|.::..:::    
Mouse   409 MVAFRNVVNGQPFANW--WDNDSNQVAFGRGNKGF--------------IVFNNDDWALSETLQT 457

  Fly   406 ------YRDISWSDTVDQPACEAGIDNYKTISRDPERTPMQWSSDVNAGFS---SADRTWLPVNP 461
                  |.|:...|.||...  .||..|.             .:|..|.||   ||:..::.::.
Mouse   458 GLPAGTYCDVISGDKVDGNC--TGIKVYV-------------GNDGKAHFSISNSAEDPFIAIHA 507

  Fly   462 NYK 464
            ..|
Mouse   508 ESK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 104/523 (20%)
trehalose_treC 33..538 CDD:274115 104/523 (20%)
Amy1NP_001103975.1 AmyAc_bac_euk_AmyA 25..416 CDD:200456 78/396 (20%)
AmyA 46..>315 CDD:223443 60/292 (21%)
Aamy_C 422..510 CDD:214749 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.