DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-B1 and Amy2a3

DIOPT Version :9

Sequence 1:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001153623.1 Gene:Amy2a3 / 100043686 MGIID:3714985 Length:508 Species:Mus musculus


Alignment Length:469 Identity:94/469 - (20%)
Similarity:152/469 - (32%) Gaps:160/469 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QYFKDTGITSVWLSPIYESPMVDFGYDISN--YTNIQP-------EYGTLEDFDALIAKANELGV 121
            :|....|...|.:||..|:.:|   ::.|.  :...||       ..|..::|..::.:.|.:||
Mouse    45 RYLAPKGFGGVQVSPPNENVVV---HNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGV 106

  Fly   122 KVILDFVPNHSSNKHPWFIKSVAREPGYEDFYVWEDGILLENGTRVPPNN-WLSVFSGSAWMWND 185
            ::.:|.|.||...         |..|.         |.....|:.:.||| .......|||.:||
Mouse   107 RIYVDAVINHMCG---------AGNPA---------GTSSTCGSYLNPNNREFPAVPYSAWDFND 153

  Fly   186 ER---------QQYYLRQFTY-GQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIY--- 237
            .:         ..|.:|.... |..||......|...:.|.|...::.|:||||:||..:::   
Mouse   154 NKCNGEIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGD 218

  Fly   238 --------------------------EDAQLRDEPPSGTTDDPNNE-------AYLSHI------ 263
                                      |...|..|...|:....|..       |.|..:      
Mouse   219 IKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNG 283

  Fly   264 ----YTRNQPEDYGLLQHWRQLLDNYTANHDG----------------------PLRIMMTEGYA 302
                |.:|..|.:||:...|.|:  :..|||.                      .:..|:...| 
Mouse   284 EKMSYLKNWGEGWGLVPSDRALV--FVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPY- 345

  Fly   303 SVSQLMEYY---------EDSNGVQGPQFPFNFDFITE--LNANSTAADFVFYISRW-------- 348
            ..:::|..|         :|.|...||  |.|.....|  :||::|..:......||        
Mouse   346 GFTRVMSSYRWNRNFQNGKDQNDWIGP--PNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVA 408

  Fly   349 LIYMPHGH-VANWVMGNHDNPRVASRFGEKSVDAMNMLLMTLPGIGITYNGEELGMT-------- 404
            ...:.:|. .:|| ..|:.| :||...|.:..              |.:|.::..::        
Mouse   409 FRNVVNGQPFSNW-WDNNSN-QVAFSRGNRGF--------------IVFNNDDWALSATLQTGLP 457

  Fly   405 --DYRDISWSDTVD 416
              .|.|:...|.||
Mouse   458 AGTYCDVISGDKVD 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 94/469 (20%)
trehalose_treC 33..538 CDD:274115 94/469 (20%)
Amy2a3NP_001153623.1 AmyAc_bac_euk_AmyA 25..413 CDD:200456 79/393 (20%)
AmyA 46..>344 CDD:223443 64/320 (20%)
Aamy_C 420..507 CDD:214749 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.