DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esc and C09G4.4

DIOPT Version :9

Sequence 1:NP_477431.1 Gene:esc / 34595 FlyBaseID:FBgn0000588 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001379648.1 Gene:C09G4.4 / 3565561 WormBaseID:WBGene00044001 Length:78 Species:Caenorhabditis elegans


Alignment Length:110 Identity:22/110 - (20%)
Similarity:32/110 - (29%) Gaps:48/110 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVF------ATAGSNRVTVYECPRQGGM 112
            |.|.|...|....|        .|.:..::.|..|:.:.|      ::|||.:            
 Worm     2 SSPTSSKDYSSPKH--------SFMLTVDSNLQSDKKKTFLNVQSSSSAGSTK------------ 46

  Fly   113 QLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDV 157
               ||......||.|.|                   ||.:..:||
 Worm    47 ---HCQIPMSKDEYFET-------------------RGKLDSVDV 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
escNP_477431.1 WD40 <67..425 CDD:225201 18/97 (19%)
WD40 72..418 CDD:295369 17/92 (18%)
WD40 repeat 76..122 CDD:293791 9/51 (18%)
WD40 repeat 128..168 CDD:293791 5/30 (17%)
WD40 repeat 173..210 CDD:293791
WD40 repeat 220..282 CDD:293791
WD40 repeat 289..337 CDD:293791
WD40 repeat 345..386 CDD:293791
WD40 repeat 393..417 CDD:293791
C09G4.4NP_001379648.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.