DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esc and C09G4.4

DIOPT Version :10

Sequence 1:NP_477431.1 Gene:esc / 34595 FlyBaseID:FBgn0000588 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001379648.1 Gene:C09G4.4 / 3565561 WormBaseID:WBGene00044001 Length:78 Species:Caenorhabditis elegans


Alignment Length:110 Identity:22/110 - (20%)
Similarity:32/110 - (29%) Gaps:48/110 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVF------ATAGSNRVTVYECPRQGGM 112
            |.|.|...|....|        .|.:..::.|..|:.:.|      ::|||.:            
 Worm     2 SSPTSSKDYSSPKH--------SFMLTVDSNLQSDKKKTFLNVQSSSSAGSTK------------ 46

  Fly   113 QLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDV 157
               ||......||.|.|                   ||.:..:||
 Worm    47 ---HCQIPMSKDEYFET-------------------RGKLDSVDV 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
escNP_477431.1 WD40 72..420 CDD:441893 17/92 (18%)
WD40 repeat 76..122 CDD:293791 9/51 (18%)
WD40 repeat 128..168 CDD:293791 5/30 (17%)
WD40 repeat 173..210 CDD:293791
WD40 repeat 220..282 CDD:293791
WD40 repeat 289..337 CDD:293791
WD40 repeat 345..386 CDD:293791
WD40 repeat 393..417 CDD:293791
C09G4.4NP_001379648.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.