DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde1c and Pde7a

DIOPT Version :9

Sequence 1:NP_001137817.1 Gene:Pde1c / 34594 FlyBaseID:FBgn0264815 Length:1173 Species:Drosophila melanogaster
Sequence 2:NP_112342.1 Gene:Pde7a / 81744 RGDID:68391 Length:482 Species:Rattus norvegicus


Alignment Length:351 Identity:110/351 - (31%)
Similarity:171/351 - (48%) Gaps:28/351 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 SEVQPDAVPPEVREWLASTFTRQMATSRRKSDEKPKFRSVAHAIRAGIFVDRMYRRVSSSALTAF 735
            ||::.......:|..|  :|.|.:.:||        |...|...|:...:|..|...:..     
  Rat    97 SEIEASVSARNIRRLL--SFQRYLRSSR--------FFRGATVCRSLNILDEDYNGQAKC----- 146

  Fly   736 PPDVVRLLKNLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGY 800
                  :|:.:.:|.||:|......:|..:..:.:.||:.:|.|..|.:....|..||..::|.|
  Rat   147 ------MLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDY 205

  Fly   801 CRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGS 865
             ..:|||||.:||.||.|.:|..|....|.|.:|..:|..||:||..||.:|.|....|.:.:..
  Rat   206 -HSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNH 269

  Fly   866 ETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKA 930
            ..|.||.:.:||||||..::..||||.  .:.|||..|...|:...:..::|.||::...:.:..
  Rat   270 YLATLYKNTSVLENHHWRSAVGLLRES--GLFSHLPLESRHEMEAQIGALILATDISRQNEYLSL 332

  Fly   931 MRQLLTLQEATID----KQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLP 991
            .|..|...:..:|    :..||.:.|.|.||.:|.:.|.:..:|:..:.||||.|||:||:..|.
  Rat   333 FRSHLDKGDLHLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLG 397

  Fly   992 FSPLCDRNNTLVAESQICFIDFIVEP 1017
            .||||||....:|..||.|:.::|||
  Rat   398 VSPLCDRQTESIANIQIGFMTYLVEP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde1cNP_001137817.1 PDEase_I_N 666..722 CDD:285672 11/50 (22%)
PDEase_I 807..1026 CDD:278654 79/215 (37%)
Pde7aNP_112342.1 PDEase_I 211..431 CDD:395177 79/215 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.