DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde1c and pde5a

DIOPT Version :9

Sequence 1:NP_001137817.1 Gene:Pde1c / 34594 FlyBaseID:FBgn0264815 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_012821480.2 Gene:pde5a / 780273 XenbaseID:XB-GENE-479676 Length:943 Species:Xenopus tropicalis


Alignment Length:300 Identity:78/300 - (26%)
Similarity:138/300 - (46%) Gaps:17/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   721 DRMYRRVSSSALTAFPPDVVRLLKNLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIA 785
            :.|..:|::.|:.   |....|  .|.::.|..|.|::..:    ......:|.....:..|::.
 Frog   600 ETMELQVTAGAIV---PSAQSL--KLTEFYFSDFELSDMET----TLATSRMFTDLNLVQTFQMK 655

  Fly   786 PGILEAFLHRVEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDY 850
            ...|..::..|::.| |....|||..||.:..|.:...|....:...|.||||.|.::|.|.||.
 Frog   656 YETLCRWILSVKKNY-RKNVAYHNWRHAFNTAQCMFAALRTGKIQGKLNDLEILALMIATLSHDL 719

  Fly   851 EHTGTTNNFHVMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEM 915
            :|.|..|:|...|....|.|| ..:::||||......:|......|||.||.::::.:..::.:.
 Frog   720 DHRGVNNSFIQRSEHPLAQLY-CHSIMENHHFDQCLMILNSQGNQILSGLSVQDYKTVLKMIKQA 783

  Fly   916 VLGTDMTNHFQQMKAMRQLLTLQEATID----KQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLE 976
            :|.||:..:.::.....:|:..::...|    |:..|::::..||:|...|.|.|..|...|:..
 Frog   784 ILATDLALYIKRRSDFFELVNKKKFKWDDPSQKELFLAMLMTACDLSAITKPWPVQQRIAELVAS 848

  Fly   977 EFFRQGDLE-KELGL-PFSPLCDRNNTLVAESQICFIDFI 1014
            ||:.|||.| :||.: |...:.......:...|:.|||.:
 Frog   849 EFYDQGDKERRELNIEPIDLMNREKKDKIPSMQVGFIDAV 888

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity