DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde1c and pde2a

DIOPT Version :9

Sequence 1:NP_001137817.1 Gene:Pde1c / 34594 FlyBaseID:FBgn0264815 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_031751996.1 Gene:pde2a / 780063 XenbaseID:XB-GENE-5945995 Length:964 Species:Xenopus tropicalis


Alignment Length:317 Identity:95/317 - (29%)
Similarity:158/317 - (49%) Gaps:30/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   772 LFNRYGSIHKFKIAPGILEAFLHRVEEGYCRYRN-PYHNNLHAVDVMQTIHYCLC---NTGLMNW 832
            :|...|.::.:||....|..|...|::|   ||: ||||.:||..|.   |:|..   |..|:|:
 Frog   638 MFEDMGFVNNYKIDRTTLIRFCLMVKKG---YRDPPYHNWMHAFSVS---HFCYLLFKNLELVNY 696

  Fly   833 LTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSETALLY-NDRAVLENHHASASFRLLREDEYNI 896
            |..:||||..::.|.||.:|.||.|:|.|.|.|..|.|| ::.:|:|.||.:.:..:|.....||
 Frog   697 LEYIEIFALFVSCLCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNSQGCNI 761

  Fly   897 LSHLSREEFRELRGLVIEMVLGTDMTNHFQQMKAMRQLLTLQEATIDKQK------VLSLVLHCC 955
            |...||::::.:..|:.:::|.||:.:|   ::..::|..:.:...|.|.      ::.|::...
 Frog   762 LEQFSRKDYQRMLDLMRDIILATDLAHH---LRIFKELTRMSQDGFDPQNKHHHYLLICLLMTSS 823

  Fly   956 DISHPAKQWGVHHRWTMLLLEEFFRQGDLEKELGLPFSPLCDRNNTLVAESQICFIDFIVEPSMG 1020
            |:|...|.|....:...|:.:|||.||||||.:|...|.:.||....:.|.||.|::.|..|...
 Frog   824 DLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPSEMMDREKAYIPELQISFMEHIAMPIYN 888

  Fly  1021 VMSDML--ELILAPIAPMNKSKPATLVEHETTANSTTNSAIVIPNSGITPSMDKPRD 1075
            ::.|:.  ...|......|:.| .|.|.|:.|...       :|::.....:|:..|
 Frog   889 LLKDLFPRSAELYERVATNREK-WTRVSHKFTIRG-------LPSNNSLDFLDEEYD 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde1cNP_001137817.1 PDEase_I_N 666..722 CDD:285672
PDEase_I 807..1026 CDD:278654 74/228 (32%)
pde2aXP_031751996.1 GAF 255..401 CDD:214500
GAF 423..574 CDD:214500
PDEase_I 671..904 CDD:395177 75/238 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.