DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde1c and Pde5a

DIOPT Version :9

Sequence 1:NP_001137817.1 Gene:Pde1c / 34594 FlyBaseID:FBgn0264815 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_006233322.1 Gene:Pde5a / 171115 RGDID:620995 Length:865 Species:Rattus norvegicus


Alignment Length:340 Identity:95/340 - (27%)
Similarity:154/340 - (45%) Gaps:21/340 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   731 ALTAFPPDVVRLLKNLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHR 795
            ||.|......:.|| :.|::|..|.|::..:.    .....:|.....:..|::...:|..::..
  Rat   532 ALAAAVVPSAQTLK-ITDFSFSDFELSDLETA----LCTIRMFTDLNLVQNFQMKHEVLCRWILS 591

  Fly   796 VEEGYCRYRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFH 860
            |::.| |....|||..||.:..|.:...|....:.|.|||||..|.|:|||.||.:|.|..|::.
  Rat   592 VKKNY-RKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLETLALLIAALSHDLDHRGVNNSYI 655

  Fly   861 VMSGSETALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHF 925
            ..|....|.|| ..:.:|:||......:|......|||.||.||::....::.:.:|.||:..:.
  Rat   656 QRSEHPLAQLY-CHSTMEHHHFDQCLMVLNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYI 719

  Fly   926 QQMKAMRQLLTLQEAT----IDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLE- 985
            ::.....:|:...|.:    :.|:..|::::..||:|...|.|.:..|...|:..|||.|||.| 
  Rat   720 KRRGEFFELIRKNEFSFEDPLQKELFLAMLMTACDLSAITKPWPIQQRIAELVAAEFFDQGDRER 784

  Fly   986 KELGLPFSPLCDR-NNTLVAESQICFIDFI----VEPSMGVMSDMLELILAPIAPMNKSKPATLV 1045
            |||.:..:.|.:| ....:...|:.|||.|    .|....|..|.|.|:..  ...|:.|...|.
  Rat   785 KELNMEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCLPLLDG--CRKNRQKWQALA 847

  Fly  1046 EHE--TTANSTTNSA 1058
            :.:  |..|..:..|
  Rat   848 DQQEKTLLNGESGQA 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde1cNP_001137817.1 PDEase_I_N 666..722 CDD:285672
PDEase_I 807..1026 CDD:278654 72/228 (32%)
Pde5aXP_006233322.1 GAF 154..311 CDD:214500
GAF 337..503 CDD:214500
PDEase_I 602..837 CDD:278654 74/237 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.