DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde1c and pde5aa

DIOPT Version :9

Sequence 1:NP_001137817.1 Gene:Pde1c / 34594 FlyBaseID:FBgn0264815 Length:1173 Species:Drosophila melanogaster
Sequence 2:XP_009305135.1 Gene:pde5aa / 100334568 ZFINID:ZDB-GENE-100414-2 Length:922 Species:Danio rerio


Alignment Length:307 Identity:85/307 - (27%)
Similarity:140/307 - (45%) Gaps:20/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 DVVRLLKNLDDWTFDVFALTEAASGQVVKYVAYELFNRYGSIHKFKIAPGILEAFLHRVEEGYCR 802
            |.:.||    |:.|..|.:::.|..|.|    ..:|.......:|||....|..::..|::.| |
Zfish   604 DTLSLL----DFGFSDFDMSQNAMTQAV----VRMFLDLNLPQEFKIDYKALCQWVLSVQKCY-R 659

  Fly   803 YRNPYHNNLHAVDVMQTIHYCLCNTGLMNWLTDLEIFASLLAALLHDYEHTGTTNNFHVMSGSET 867
            ....|||..||:...|.:...|....|.:.|:.||:.|.::|:|.||.:|.|..|::...|....
Zfish   660 SNVVYHNWSHALRTAQCMFAMLQTKELKSNLSSLEVLALMIASLSHDLDHRGVNNSYIQRSNQPL 724

  Fly   868 ALLYNDRAVLENHHASASFRLLREDEYNILSHLSREEFRELRGLVIEMVLGTDMTNHFQQ----M 928
            |.||. ::.||:||......:|......|||.||..|:.....::.:.:|.||:...|::    .
Zfish   725 AQLYG-QSSLEHHHYDMCLLILNNPGSQILSSLSVNEYMACLQMIEKNILATDLAIFFEKRTKFF 788

  Fly   929 KAMRQLLTLQEATIDKQKVLSLVLHCCDISHPAKQWGVHHRWTMLLLEEFFRQGDLEK-ELGLPF 992
            |.......|.:....::.:.|:::...||....|.|.|..|...|:..||:.|||.|| ||.:..
Zfish   789 KLAENNSCLWKDEGHRELLRSMLMTASDICAITKPWPVQKRIAELVATEFYAQGDREKRELNIQP 853

  Fly   993 SPLCDRNN-TLVAESQICFIDFIVEPSMGVMSDMLELILAPIAPMNK 1038
            ..:.||.| :.:.:.|:.:||.|..|    :.:.|..|....:|:.:
Zfish   854 IDVMDRENASRLPQMQVDYIDGICSP----LYEALAFICESCSPLKE 896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde1cNP_001137817.1 PDEase_I_N 666..722 CDD:285672
PDEase_I 807..1026 CDD:278654 65/224 (29%)
pde5aaXP_009305135.1 GAF 245..388 CDD:214500
GAF 415..558 CDD:307634
PDEase_I 664..894 CDD:306695 67/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.