DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZNF468

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_016882932.1 Gene:ZNF468 / 90333 HGNCID:33105 Length:541 Species:Homo sapiens


Alignment Length:494 Identity:166/494 - (33%)
Similarity:229/494 - (46%) Gaps:68/494 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TSSSTSSGGS------TTSGGTTTTAGELLMPKMEGGIHGVDGSGNGGNGGGQNVALAPDGTPIA 217
            |.|||..|.:      |.....:...||....::|..|||.:.........|.          .|
Human    76 TLSSTGQGNTEVIHTGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGH----------AA 130

  Fly   218 TGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGF------------------------ 258
            ..|.:.::.|...|       |.:.|:..|....|: |..|                        
Human   131 PMTEIKELAGSTGQ-------HDQRHAGNKRIKDQL-GSSFHLHLPEPHIFQSEGKIGNQVEKSI 187

  Fly   259 ------TTSQDLTRHGKIHIGGPMFTCIVCFNVFANN----TSLERHMKRHSTDKPFACTICQKT 313
                  :|||.:....|.||.          |.:.||    :.|.:..:.|..:|.|.|....|:
Human   188 NNASSVSTSQRICCRPKTHIS----------NKYGNNSLHSSLLTQKWEVHMREKSFECIQSFKS 242

  Fly   314 FARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVN 378
            |.....|..|...|..|...:|..|.|.|.:|.::..|.|.||||.|::|:.|.|:|........
Human   243 FNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFI 307

  Fly   379 HYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGET 443
            |...|||:.|::|:.|.|.::||.||..|.|.||.|.|::|::|.::|:...:...|.:.||||.
Human   308 HKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHTGEK 372

  Fly   444 PHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTK 508
            |:.|:.|.|.|.|...|..|.|.||||.|::|..|.|.|:||.||..|.|.|:||.|:||..|.|
Human   373 PYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCK 437

  Fly   509 AFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLT 573
            .|:||.::..|.|.||||.|:||..|.|.|.|..||..|.|.|||:.|::|:.|.|||.:...|.
Human   438 VFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLI 502

  Fly   574 NHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP 612
            .|.|||||:.|:||..|.|||::...|..|.|.||.:.|
Human   503 IHRRLHTGEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 3/19 (16%)
C2H2 Zn finger 251..271 CDD:275368 7/49 (14%)
C2H2 Zn finger 279..299 CDD:275368 4/23 (17%)
COG5048 300..723 CDD:227381 132/313 (42%)
C2H2 Zn finger 307..327 CDD:275368 5/19 (26%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
C2H2 Zn finger 419..439 CDD:275368 4/19 (21%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
C2H2 Zn finger 531..551 CDD:275368 9/19 (47%)
C2H2 Zn finger 559..579 CDD:275368 8/19 (42%)
C2H2 Zn finger 587..607 CDD:275368 8/19 (42%)
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
ZNF468XP_016882932.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100020
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.