DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and PGBD1

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001171672.1 Gene:PGBD1 / 84547 HGNCID:19398 Length:809 Species:Homo sapiens


Alignment Length:403 Identity:65/403 - (16%)
Similarity:118/403 - (29%) Gaps:145/403 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 SPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETC 647
            |.|..|.|:..|       .|.....:..|            :|.|......||...||      
Human    36 SSHTQEICRLRF-------RHFCYQEAHGP------------QEALAQLRELCHQWLRP------ 75

  Fly   648 GKSFPLKGNLLFHQRSHTKGQEME----------RPFACEKCPKNFICKGHLVSHMRSHSGEKPH 702
                          ..|||.|.||          .|...:.|.|.:..:          |||:  
Human    76 --------------EMHTKEQIMELLVLEQFLTILPKELQPCVKTYPLE----------SGEE-- 114

  Fly   703 ACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVKPIIIPHHSATTTM 767
            |.|:........|:..:.                      |.|..| .|::.|::..:.      
Human   115 AVTVLENLETGSGDTGQQ----------------------ASVYIQ-GQDMHPMVAEYQ------ 150

  Fly   768 HTIQQITAGAAGGAGAVQLTPGLV-------------PLVTSTLISHNAA-AQQQSQKQQAAAAA 818
                    |.:....::||.||:.             |...|..:.|.:| .|:::.:.:|....
Human   151 --------GVSLECQSLQLLPGITTLKCEPPQRPQGNPQEVSGPVPHGSAHLQEKNPRDKAVVPV 207

  Fly   819 AAQQQAAAAAAAQQQAAQQQAAA--AHQQHQQQVAAQHQQQAAVAAHQQQQQQLQQQQQLLQLSI 881
            ....::......:::.||..||.  :|....::....:..|..|.:.....:::..:.:|.:   
Human   208 FNPVRSQTLVKTEEETAQAVAAEKWSHLSLTRRNLCGNSAQETVMSLSPMTEEIVTKDRLFK--- 269

  Fly   882 QQAAHHHQQEQHRQQQQQQHQQQQQQQHHQQQQQGHPQAPPPQQQQQPPPIALISDPSALARAAI 946
                        .:|:..:..:|..:...:..::..||.|             .|.|.|..|.  
Human   270 ------------AKQETSEEMEQSGEASGKPNRECAPQIP-------------CSTPIATERT-- 307

  Fly   947 QLQHLPANVEQHP 959
             :.||....::||
Human   308 -VAHLNTLKDRHP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
C2H2 Zn finger 279..299 CDD:275368
COG5048 300..723 CDD:227381 28/149 (19%)
C2H2 Zn finger 307..327 CDD:275368
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368
C2H2 Zn finger 391..411 CDD:275368
C2H2 Zn finger 419..439 CDD:275368
C2H2 Zn finger 447..467 CDD:275368
C2H2 Zn finger 475..495 CDD:275368
C2H2 Zn finger 503..523 CDD:275368
C2H2 Zn finger 531..551 CDD:275368
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368 4/19 (21%)
C2H2 Zn finger 615..636 CDD:275368 2/20 (10%)
C2H2 Zn finger 644..664 CDD:275368 0/19 (0%)
C2H2 Zn finger 676..696 CDD:275368 2/19 (11%)
C2H2 Zn finger 704..722 CDD:275368 2/17 (12%)
PGBD1NP_001171672.1 SCAN 40..142 CDD:128708 30/175 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..297 4/25 (16%)
DDE_Tnp_1_7 418..775 CDD:372752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.