DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZSCAN16

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001307484.1 Gene:ZSCAN16 / 80345 HGNCID:20813 Length:348 Species:Homo sapiens


Alignment Length:127 Identity:49/127 - (38%)
Similarity:71/127 - (55%) Gaps:3/127 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 KEHLANHMRSHTNETP---FRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLN 462
            |:.:.|..||...:..   ::|:.||||||.....:.|...||||.|::||.|.|.|.::.||:.
Human   217 KDIIENEGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIG 281

  Fly   463 HVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHT 524
            |.|.|||..|::|..|.|.|:.:..|:.|.|.||||.|::|..|.:.|.....::.|.|.||
Human   282 HHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHT 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
C2H2 Zn finger 279..299 CDD:275368
COG5048 300..723 CDD:227381 49/127 (39%)
C2H2 Zn finger 307..327 CDD:275368
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368
C2H2 Zn finger 391..411 CDD:275368 3/9 (33%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
C2H2 Zn finger 503..523 CDD:275368 5/19 (26%)
C2H2 Zn finger 531..551 CDD:275368
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
ZSCAN16NP_001307484.1 SCAN 37..148 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..184
COG5048 <183..323 CDD:227381 42/105 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..226 2/8 (25%)
C2H2 Zn finger 238..258 CDD:275368 8/19 (42%)
C2H2 Zn finger 266..286 CDD:275368 9/19 (47%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
zf-C2H2 320..342 CDD:306579 5/21 (24%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.