DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZSCAN26

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001018854.2 Gene:ZSCAN26 / 7741 HGNCID:12978 Length:479 Species:Homo sapiens


Alignment Length:289 Identity:98/289 - (33%)
Similarity:144/289 - (49%) Gaps:12/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLD--NHFRSHTGE 330
            |::...|.:...:...|   ..::||||..:......:.|:..::.|.  :|||  .|..:|||:
Human   198 GRVESSGKISEPMEAHN---EGSNLERHQAKPKEKIEYKCSEREQRFI--QHLDLIEHASTHTGK 257

  Fly   331 TPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCG 395
                 :.|.....:...:..|.:..:.|..|:|..|.|:|.|..|.|.|...|.|:.|:||:.||
Human   258 -----KLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHLVRHQKIHLGEKPYQCNECG 317

  Fly   396 KKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL 460
            |.:::...|..|:|.||.|.|:.|..|||:|.|..|...|...|:.|.|..|..|.|||::...|
Human   318 KVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRIHSQEEPCECKECGKTFSQALLL 382

  Fly   461 LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTG 525
            .:|.|.|:....|:|:.|.|.|:....|:.|.|.||||.||||..|.|||....|:..|||.|..
Human   383 THHQRIHSHSKSHQCNECGKAFSLTSDLIRHHRIHTGEKPFKCNICQKAFRLNSHLAQHVRIHNE 447

  Fly   526 ESPHKCTYCTKTFTRKEHLTNHVRQHTGD 554
            |.|::|:.|.:.|.::..|..|.|.|..|
Human   448 EKPYQCSECGEAFRQRSGLFQHQRYHHKD 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368 1/2 (50%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
COG5048 300..723 CDD:227381 91/257 (35%)
C2H2 Zn finger 307..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 335..355 CDD:275368 2/19 (11%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
C2H2 Zn finger 503..523 CDD:275368 9/19 (47%)
C2H2 Zn finger 531..551 CDD:275368 6/19 (32%)
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
ZSCAN26NP_001018854.2 SCAN 47..135 CDD:280241
SCAN 52..158 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 6/28 (21%)
C2H2 Zn finger 234..254 CDD:275368 6/21 (29%)
zf-C2H2 283..305 CDD:278523 9/21 (43%)
C2H2 Zn finger 285..305 CDD:275368 8/19 (42%)
COG5048 <290..469 CDD:227381 72/178 (40%)
zf-H2C2_2 297..322 CDD:290200 11/24 (46%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 326..350 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..361 CDD:275368 8/19 (42%)
zf-H2C2_2 353..378 CDD:290200 10/24 (42%)
C2H2 Zn finger 369..389 CDD:275368 8/19 (42%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
zf-H2C2_2 409..432 CDD:290200 13/22 (59%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..462 CDD:290200 10/24 (42%)
C2H2 Zn finger 453..473 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.