DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZNF222

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001123468.1 Gene:ZNF222 / 7673 HGNCID:13015 Length:491 Species:Homo sapiens


Alignment Length:517 Identity:155/517 - (29%)
Similarity:214/517 - (41%) Gaps:117/517 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 FRYQLIV-HRRYHSERKPFMCQ----VCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTS 291
            ||..|.| |:.:|.:...|:.:    |.|   ||||   |.|  ::||.:            .|.
Human    50 FRNLLSVGHQPFHGDTFHFLREEKFWV
MG---TTSQ---REG--NLGGKI------------QTE 94

  Fly   292 LERHMKRHSTDKPFAC-----------TICQKTFARKEHL----DNHFR-------SHTGETPFR 334
            :|. :....|.:.|:|           |..|.|......|    ||..:       .||.|.||:
Human    95 MET-VPEAGTHEEFSCKQIWEQIASDLTRSQDTTISNSQLFEQDDNPSQIKARLSTVHTREKPFQ 158

  Fly   335 CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVN----HYMWHTGQTPHQCDVCG 395
            .:.|.:.|:.........:.::||..|.||.|.|||.    |::    |...|.|...::|||||
Human   159 GENCKQFFSDVSFFDLPQQLYSGEKSHTCDECGKSFC----YISALHIHQRVHMGVKCYKCDVCG 219

  Fly   396 KKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL 460
            |::::...|..|.|.||.|.||:||.|||.|                   ||         :..|
Human   220 KEFSQSSRLQTHQRVHTGEKPFKCEQCGKGF-------------------RC---------RSAL 256

  Fly   461 LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTG 525
            ..|.:.|..|.|:.|..|.|.|.....|..|.|.||||.||||..|.|:|..:..:..|...||.
Human   257 KVHCKLHMREKPYNCEKCGKAFMHNFQLQKHHRIHTGEKPFKCEICGKSFCLRSSLNRHCMVHTA 321

  Fly   526 ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYC 590
            |..:|.....:.|..:..|..|...|.|..|:.|..|.|:|....:|..|.|:|||:.|:|||.|
Human   322 EKLYKSEKYGRGFIDRLDLHKHQMIHMGQKPYNCKECGKSFKWSSYLLVHQRVHTGEKPYKCEEC 386

  Fly   591 QKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKG 655
            .|.:..|..|:.|                             .|.|||:|.:.|:.|||||....
Human   387 GKGYISKSGLDFH-----------------------------HRTHTGERSYNCDNCGKSFRHAS 422

  Fly   656 NLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNL 717
            ::|.|::.|.:    .:|..||.|.|..:|:.:.....|.||||.|..|..|.|.:..|.||
Human   423 SILNHKKLHCQ----RKPLKCEDCGKRLVCRSYCKDQQRDHSGENPSKCEDCGKRYKRRLNL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 5/11 (45%)
C2H2 Zn finger 251..271 CDD:275368 8/23 (35%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
COG5048 300..723 CDD:227381 136/444 (31%)
C2H2 Zn finger 307..327 CDD:275368 7/41 (17%)
C2H2 Zn finger 335..355 CDD:275368 2/19 (11%)
C2H2 Zn finger 363..383 CDD:275368 8/23 (35%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 3/19 (16%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
C2H2 Zn finger 503..523 CDD:275368 5/19 (26%)
C2H2 Zn finger 531..551 CDD:275368 3/19 (16%)
C2H2 Zn finger 559..579 CDD:275368 7/19 (37%)
C2H2 Zn finger 587..607 CDD:275368 7/19 (37%)
C2H2 Zn finger 615..636 CDD:275368 1/20 (5%)
C2H2 Zn finger 644..664 CDD:275368 8/19 (42%)
C2H2 Zn finger 676..696 CDD:275368 6/19 (32%)
C2H2 Zn finger 704..722 CDD:275368 6/14 (43%)
ZNF222NP_001123468.1 KRAB 17..76 CDD:214630 7/25 (28%)
KRAB 17..56 CDD:279668 3/5 (60%)
C2H2 Zn finger 160..179 CDD:275368 2/18 (11%)
COG5048 <183..315 CDD:227381 56/163 (34%)
C2H2 Zn finger 187..207 CDD:275368 8/23 (35%)
C2H2 Zn finger 215..235 CDD:275368 9/19 (47%)
zf-H2C2_2 228..252 CDD:290200 14/42 (33%)
C2H2 Zn finger 243..263 CDD:275368 10/47 (21%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
zf-H2C2_2 284..306 CDD:290200 13/21 (62%)
C2H2 Zn finger 331..347 CDD:275368 3/15 (20%)
C2H2 Zn finger 355..375 CDD:275368 7/19 (37%)
zf-H2C2_2 367..390 CDD:290200 12/22 (55%)
C2H2 Zn finger 383..403 CDD:275368 8/48 (17%)
C2H2 Zn finger 411..431 CDD:275368 8/19 (42%)
C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100020
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.