DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZNF26

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_016875409.1 Gene:ZNF26 / 7574 HGNCID:13053 Length:575 Species:Homo sapiens


Alignment Length:442 Identity:167/442 - (37%)
Similarity:228/442 - (51%) Gaps:31/442 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 SERKPFMCQVCGQ-GFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLER------------- 294
            |..:.:.|.|.|: ..:.:.|.:|....:..|...|         .|::..|             
Human   143 SIERSYACSVLGRLNLSKTHDSSRQRLYNTRGKSLT---------QNSAPSRSYLRKNPDKFHGY 198

  Fly   295 -------HMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHV 352
                   |.:.||.:|...|:.|.|.|..|..|..|.|.||||.|:.|..|.:.|:.|.::..|.
Human   199 EEPYFLKHQRAHSIEKNCVCSECGKAFRCKSQLIVHLRIHTGERPYECSKCERAFSAKSNLNAHQ 263

  Fly   353 RKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPF 417
            |.||||.|:.|..|:|.|:.:...:.|...|||..|:.|..|||.|:.|..|..|.||||...|:
Human   264 RVHTGEKPYSCSECEKVFSFRSQLIVHQEIHTGGKPYGCSECGKAYSWKSQLLLHQRSHTGVKPY 328

  Fly   418 RCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF 482
            .|..|||:||.|..|..|...|||..||:|..|.|.|..|.:||.|:|.||||.|::||.|.|.|
Human   329 ECSECGKAFSLKSPFVVHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKAF 393

  Fly   483 TRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNH 547
            ..|..|:.|...|||..|::|..|.|||.||:.:..|:|.|.||.|:.|:.|.|.|:.|.:|..|
Human   394 NMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIH 458

  Fly   548 VRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP 612
            .|.|||:.|:.||.|::.|..|..|..|.|.|:.:.|::|..|:|.:.||..|..|.:.||.:.|
Human   459 RRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKP 523

  Fly   613 HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSH 664
            ..|:.|.|.||:|..|..| .|.|||::|:.|..|||||.....|..|:::|
Human   524 FKCSECGKAFTQKSSLSEH-QRVHTGEKPWKCSECGKSFCWNSGLRIHRKTH 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368 5/20 (25%)
C2H2 Zn finger 279..299 CDD:275368 3/39 (8%)
COG5048 300..723 CDD:227381 155/365 (42%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
C2H2 Zn finger 419..439 CDD:275368 9/19 (47%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
C2H2 Zn finger 503..523 CDD:275368 9/19 (47%)
C2H2 Zn finger 531..551 CDD:275368 8/19 (42%)
C2H2 Zn finger 559..579 CDD:275368 8/19 (42%)
C2H2 Zn finger 587..607 CDD:275368 7/19 (37%)
C2H2 Zn finger 615..636 CDD:275368 9/20 (45%)
C2H2 Zn finger 644..664 CDD:275368 8/19 (42%)
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
ZNF26XP_016875409.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 499 1.000 Inparanoid score I1378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.