Sequence 1: | NP_001245993.1 | Gene: | crol / 34592 | FlyBaseID: | FBgn0020309 | Length: | 962 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362744.1 | Gene: | ZNF24 / 7572 | HGNCID: | 13032 | Length: | 368 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 67/199 - (33%) |
---|---|---|---|
Similarity: | 98/199 - (49%) | Gaps: | 29/199 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 374 EHYVNHYMWHTGQTPHQCDVCGK----KYTRKEHLANHMRSHTNETP----------FRC-EIC- 422
Fly 423 --GKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRK 485
Fly 486 EHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ 550
Fly 551 HTGD 554 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |