DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZNF649

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_075562.2 Gene:ZNF649 / 65251 HGNCID:25741 Length:505 Species:Homo sapiens


Alignment Length:494 Identity:164/494 - (33%)
Similarity:225/494 - (45%) Gaps:78/494 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 KIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPF 333
            |:..|.|::|             ||..:  ||...|           ..|..|:|.     :.|.
Human    59 KLEQGEPLWT
-------------LEDEI--HSPAHP-----------EIEKADDHL-----QQPL 92

  Fly   334 RCQYCAK-TFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEH----------YVNHYMWHTGQT 387
            :.|...| |..|.|| ...::.:.|.|..     .:.:.|||.          :.||     .|.
Human    93 QNQKILKRTGQRYEH-GRTLKSYLGLTNQ-----SRRYNRKEPAEFNGDGAFLHDNH-----EQM 146

  Fly   388 PHQCDV--CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFC 450
            |.:.:.  ..|..:.|.....|.::|..|....|..|||:|.:|...|.|...|||:.||.|..|
Human   147 PTEIEFPESRKPISTKSQFLKHQQTHNIEKAHECTDCGKAFLKKSQLTEHKRIHTGKKPHVCSLC 211

  Fly   451 SKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDH 515
            .|.|.:|..|..|.|.|.||.||.||.|.|.|.::..|..|.|.|.||.|:.|:.|.|||.||..
Human   212 GKAFYKKYRLTEHERAHRGEKPHGCSLCGKAFYKRYRLTEHERAHKGEKPYGCSECGKAFPRKSE 276

  Fly   516 MVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHT 580
            :..|.|.|||..||:|:.|.:.|:||..|..|.|.|||:.||.||.|.|.|.:|.:|..|.|.||
Human   277 LTEHQRIHTGIKPHQCSECGRAFSRKSLLVVHQRTHTGEKPHTCSECGKGFIQKGNLNIHQRTHT 341

  Fly   581 GDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCE 645
            |:.|:.|..|.|.|::|..|..|.|.|:...|..|..|.:|.::|..||.| .:.|:|::|:.|.
Human   342 GEKPYGCIDCGKAFSQKSCLVAHQRYHTGKTPFVCPECGQPCSQKSGLIRH-QKIHSGEKPYKCS 405

  Fly   646 TCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKA 710
            .|||:|..|..|:.|.|:||.    |||:.|::|.|.:.....||.|.|.||.||          
Human   406 DCGKAFLTKTMLIVHHRTHTG----ERPYGCDECEKAYFYMSCLVKHKRIHSREK---------- 456

  Fly   711 FVERGNLKRHMKMNHPDAMMP--PPPVHPHPQIPAGVLT 747
               ||:   .:|:.:|.....  .|..|...:.|..::|
Human   457 ---RGD---SVKVENPSTASHSLSPSEHVQGKSPVNMVT 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368 1/1 (100%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
COG5048 300..723 CDD:227381 151/435 (35%)
C2H2 Zn finger 307..327 CDD:275368 3/19 (16%)
C2H2 Zn finger 335..355 CDD:275368 6/20 (30%)
C2H2 Zn finger 363..383 CDD:275368 5/29 (17%)
C2H2 Zn finger 391..411 CDD:275368 3/21 (14%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
C2H2 Zn finger 503..523 CDD:275368 9/19 (47%)
C2H2 Zn finger 531..551 CDD:275368 8/19 (42%)
C2H2 Zn finger 559..579 CDD:275368 9/19 (47%)
C2H2 Zn finger 587..607 CDD:275368 8/19 (42%)
C2H2 Zn finger 615..636 CDD:275368 7/20 (35%)
C2H2 Zn finger 644..664 CDD:275368 9/19 (47%)
C2H2 Zn finger 676..696 CDD:275368 7/19 (37%)
C2H2 Zn finger 704..722 CDD:275368 2/17 (12%)
ZNF649NP_075562.2 KRAB 8..68 CDD:214630 3/8 (38%)
KRAB 8..47 CDD:279668
C2H2 Zn finger 180..200 CDD:275368 8/19 (42%)
zf-H2C2_2 193..215 CDD:290200 10/21 (48%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
COG5048 260..>321 CDD:227381 28/60 (47%)
C2H2 Zn finger 264..284 CDD:275368 9/19 (47%)
zf-H2C2_2 276..301 CDD:290200 10/24 (42%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 305..329 CDD:290200 13/23 (57%)
C2H2 Zn finger 320..340 CDD:275368 9/19 (47%)
zf-H2C2_2 332..357 CDD:290200 11/24 (46%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..396 CDD:275368 7/20 (35%)
zf-H2C2_2 389..413 CDD:290200 11/24 (46%)
C2H2 Zn finger 404..424 CDD:275368 9/19 (47%)
C2H2 Zn finger 432..452 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..481 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.