DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZNF571

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_016882344.1 Gene:ZNF571 / 51276 HGNCID:25000 Length:651 Species:Homo sapiens


Alignment Length:483 Identity:182/483 - (37%)
Similarity:244/483 - (50%) Gaps:6/483 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PIATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC 279
            |.....:.|..|.:.|.:...||.|...|:..|....:.....|:......:|.:|..|...:.|
Human   175 PTKEKLYKCKECRQGFSYLSCLIQHEENHNIEKCSEVKKHRNTFSKKPSYIQHQRIQTGEKPYEC 239

  Fly   280 IVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTR 344
            :.|...|...:.|.:|.|.|:.:||:.|..|.|.|.|...|..|.|.||||.|:.|:.|.|.|:.
Human   240 MECGKAFGRTSDLIQHQKIHTNEKPYQCNACGKAFIRGSQLTEHQRVHTGEKPYECKKCGKAFSY 304

  Fly   345 KEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR 409
            ......|.|.|:||.|:.|..|.|:|........|...|:|:.|::|..|||.:....||..|.|
Human   305 CSQYTLHQRIHSGEKPYECKDCGKAFILGSQLTYHQRIHSGEKPYECKECGKAFILGSHLTYHQR 369

  Fly   410 SHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHR 474
            .||.|.|:.|:.|||:|........|...||||.|:.|..|.|||.|...|..|:|.|:||.|::
Human   370 VHTGEKPYICKECGKAFLCASQLNEHQRIHTGEKPYECKECGKTFFRGSQLTYHLRVHSGERPYK 434

  Fly   475 CSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFT 539
            |..|.|.|....:|:.|.|.||||.|:||..|.|||.....:..|.|.||||.|.:|..|.|.|.
Human   435 CKECGKAFISNSNLIQHQRIHTGEKPYKCKECGKAFICGKQLSEHQRIHTGEKPFECKECGKAFI 499

  Fly   540 RKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM 604
            |..:||.|.:.| |:..:.|..|.|||.|...||.|.|:|||:.|:||:.|.|.|.....|:.|.
Human   500 RVAYLTQHEKIH-GEKHYECKECGKTFVRATQLTYHQRIHTGEKPYKCKECDKAFIYGSQLSEHQ 563

  Fly   605 RQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQE 669
            |.|..:.|:.|..|.|.|.|..||..|: |.|||::|:.|:.||::|.....|..|||.||.   
Human   564 RIHRGEKPYECKQCGKAFIRGSHLTEHL-RTHTGEKPYECKECGRAFSRGSELTLHQRIHTG--- 624

  Fly   670 MERPFACEKCPKNFICKGHLVSHMRSHS 697
             |:|:.|.:|.|:|.|...|..|.|.|:
Human   625 -EKPYTCVQCGKDFRCPSQLTQHTRLHN 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
C2H2 Zn finger 251..271 CDD:275368 2/19 (11%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
COG5048 300..723 CDD:227381 162/398 (41%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
C2H2 Zn finger 531..551 CDD:275368 8/19 (42%)
C2H2 Zn finger 559..579 CDD:275368 10/19 (53%)
C2H2 Zn finger 587..607 CDD:275368 7/19 (37%)
C2H2 Zn finger 615..636 CDD:275368 9/20 (45%)
C2H2 Zn finger 644..664 CDD:275368 8/19 (42%)
C2H2 Zn finger 676..696 CDD:275368 8/19 (42%)
C2H2 Zn finger 704..722 CDD:275368
ZNF571XP_016882344.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 499 1.000 Inparanoid score I1378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100020
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.