DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crol and ZNF274

DIOPT Version :9

Sequence 1:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_598009.1 Gene:ZNF274 / 10782 HGNCID:13068 Length:653 Species:Homo sapiens


Alignment Length:202 Identity:69/202 - (34%)
Similarity:101/202 - (50%) Gaps:18/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 RHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGE 358
            :.||.:|..|     |.||:..|::..:.:             .|.|||:|....:..:|.|.|.
Human   458 KSMKHNSRVK-----IHQKSCERQKAKEGN-------------GCRKTFSRSTKQITFIRIHKGS 504

  Fly   359 TPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICG 423
            ...||..|.|.|....::..|...|||:.|:.|..|||.:.:...|..|.|.|:.|.||.|:.||
Human   505 QVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQECG 569

  Fly   424 KSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHL 488
            ::|:.:...:.|:..|||..|::|..|.|.|.:..||:.|.|.||||.|:.|:.|.|.||:..||
Human   570 RTFNDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHL 634

  Fly   489 VNHIRQH 495
            :.|.|.|
Human   635 IGHQRTH 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
C2H2 Zn finger 279..299 CDD:275368 2/4 (50%)
COG5048 300..723 CDD:227381 67/196 (34%)
C2H2 Zn finger 307..327 CDD:275368 4/19 (21%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
C2H2 Zn finger 419..439 CDD:275368 5/19 (26%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)
C2H2 Zn finger 475..495 CDD:275368 9/19 (47%)
C2H2 Zn finger 503..523 CDD:275368
C2H2 Zn finger 531..551 CDD:275368
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
ZNF274NP_598009.1 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..159
SCAN 157..269 CDD:128708
SCAN 157..245 CDD:280241
KRAB 287..>327 CDD:214630
KRAB 287..326 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..359
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..414
COG5048 <389..644 CDD:227381 69/202 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..485 8/44 (18%)
C2H2 Zn finger 481..501 CDD:275368 6/32 (19%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
zf-H2C2_2 521..546 CDD:290200 9/24 (38%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
zf-H2C2_2 549..573 CDD:290200 10/23 (43%)
zf-C2H2 563..585 CDD:278523 6/21 (29%)
C2H2 Zn finger 565..585 CDD:275368 5/19 (26%)
zf-C2H2 591..613 CDD:278523 8/21 (38%)
C2H2 Zn finger 593..613 CDD:275368 8/19 (42%)
zf-H2C2_2 605..630 CDD:290200 13/24 (54%)
C2H2 Zn finger 621..641 CDD:275368 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..653 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.