DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14937 and CG13088

DIOPT Version :9

Sequence 1:NP_609518.1 Gene:CG14937 / 34591 FlyBaseID:FBgn0032377 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_609234.2 Gene:CG13088 / 34180 FlyBaseID:FBgn0032047 Length:401 Species:Drosophila melanogaster


Alignment Length:463 Identity:107/463 - (23%)
Similarity:188/463 - (40%) Gaps:120/463 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLNDDVLALIIRQLDTYQQFQISRLNRRLAGVVHMLWE-------TRV------RNVVLQDEMFG 67
            |:|:||...|::.|....|..:..:|..::..|...|.       ||.      ||..|..|..|
  Fly     3 QINEDVWIDILKYLPMRDQLSLVEVNENISAYVKYHWSHLKTVTLTREDLDFLDRNNKLMHECLG 67

  Fly    68 -----------RSGANS--RQFVAFILALAPHMQHLSCKQLDVRRLRLLSNHTLERIHSFEWLGN 119
                       :|.::.  |::..:..   ||::.|.|..          ::.||.         
  Fly    68 GWSATVERLNLQSASSDLLRKWTEYDF---PHLRSLDCHM----------DYNLEE--------- 110

  Fly   120 VYRRRRVRFVDEDVRMLQRVFPNLKSLKLRGCQITGKYLCDLDELTDLRLHDCHFLESQHFRDIF 184
                     .||:..:|..:||.|..|.|.. ..||:||....:|.:|.|..|.:|:..||.:||
  Fly   111 ---------ADEETLLLTELFPLLTRLSLNS-STTGRYLWHWKQLRELNLTWCEYLDPDHFEEIF 165

  Fly   185 RQLRLRKFDIMEDCDEVNCCD-LADLQLCPTLEHIKIADYHVCMESDITQQLLTLPNLRKLSIYS 248
            ..|:|.|..::.....||..: :.|:..|.|||.:.|.|:|:.  .|...:|:.||:.|:|:.|:
  Fly   166 GNLQLTKLTMLYYGYNVNLGEKVVDITRCTTLEELHIDDHHLL--GDFLPRLMNLPHFRRLAFYT 228

  Fly   249 RNFVFDVLSRIVSPTSPPGDGRQIEAFSFSGVLHDYGRFFRELGNLSHLTRLELHSQPEEEEEKE 313
            |:: ::.|...|:...|    .::::..|:   ..:....|..|::.|:|.|......|::.:.:
  Fly   229 RDY-YEYLLGSVARHKP----LKVQSLLFN---DSFWSSERVAGSILHMTNLRRLVLQEDDIDAQ 285

  Fly   314 EGVQVQCLGDQILRQLASQLGELTELHLCGY-QLESPLGLLEFVINCRQLRVLDIT-------RT 370
            :           |..:..:|..|.||||... ::.||..|...:.:|..||:|:::       |:
  Fly   286 Q-----------LHTICHKLPNLEELHLLAMREVPSPSHLWNSIGHCHLLRILNLSSTKLVDLRS 339

  Fly   371 FCHGESFVWRCIAILAKQSWRIRPLELWIRHSDINPEIVQSSRCVDNIRLIKVDAKQIGPNTDYT 435
            .|..:..:.|.|           ||.|.:.::.::|..|        :|             |:.
  Fly   340 SCLTKVLLSRRI-----------PLTLHLHNTGLDPSKV--------LR-------------DFD 372

  Fly   436 SGVLKFSF 443
            |..||.||
  Fly   373 SASLKISF 380



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.