DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14937 and CG31633

DIOPT Version :9

Sequence 1:NP_609518.1 Gene:CG14937 / 34591 FlyBaseID:FBgn0032377 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_723199.1 Gene:CG31633 / 33931 FlyBaseID:FBgn0051633 Length:408 Species:Drosophila melanogaster


Alignment Length:417 Identity:99/417 - (23%)
Similarity:165/417 - (39%) Gaps:99/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNDDVLALIIRQLDTYQQFQI---SRLNRRLAGVVHMLWETRVRNVVLQDEMFGRSGANSRQFVA 78
            ||||.:..|:..||...|.::   |....||..::..:|: |.|...:....|........:|  
  Fly     7 LNDDCVLKIVDYLDLEDQLKLWKSSEPASRLRSLISYIWQ-RNREYTIDYYTFNDDYELLNEF-- 68

  Fly    79 FILALAPHMQHLSCKQLDVRRLRL--LSNHTLERIHSFEWLGNVY-RRRRVRFV---------DE 131
                       |.|.:..|..|.|  |:...|||     |.|:.: ..|::.::         |.
  Fly    69 -----------LQCIRFTVTELTLQYLAMDHLER-----WKGHTFPNMRQLIYLGDETSEIEGDA 117

  Fly   132 DVRMLQRVFPNLKSLKLRGCQITGKYLCDLDELTDLRLHDCHFLESQHFRDIFRQLRLRKFDIME 196
            |:.:|...||.|::::|.| :.||.::.....:..|.|..|.:|..|.|.||.:.|||:...|..
  Fly   118 DIAILVDCFPQLEAIRLSG-KTTGNHISRWRNIRRLDLQLCWYLSPQGFEDICQNLRLQTLSIQW 181

  Fly   197 DCDEVNC-----CDLADLQLCPTLEHIKIADYHVCMESDITQQLLTLPNLRKLSIYSRNFVFDVL 256
            ...|.|.     |.|.:      ||.::: |. |.:..|...|||:||.|.||.:::...|.|:|
  Fly   182 QKIEQNAYVRSICMLHE------LEELEL-DI-VYLNRDNISQLLSLPKLIKLRLHNFYQVDDLL 238

  Fly   257 SRIVSPTSPPGDGRQIEAFSFSG--------VLHDYGRFFRELGNLSHLTRLELHSQPEEEEEKE 313
            ..|.|..     |:.:...:||.        ||       .:|.||..||.::           :
  Fly   239 CEIGSIR-----GQDVLTAAFSNNIWMRPTEVL-------AKLRNLRCLTLVD-----------D 280

  Fly   314 EGVQVQCLGDQILRQLASQLGELT-------ELHLCGYQL-ESPLGLLEFVINCRQLRVLDITRT 370
            ||    |        .|.....:|       :|||...:: .:..|:.:.::.|.:||...:...
  Fly   281 EG----C--------AAIDFSTITYCFPLLEQLHLENSRIWVNADGIWDVLLACPRLREFSMINH 333

  Fly   371 FCHGESFVWRCIAILAKQSWRIRPLEL 397
            ..:.|.|.:....:....:.|.:||::
  Fly   334 VLYDEFFAFSKSTMNRALNQRTKPLKM 360



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.