DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and CD63

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:271 Identity:58/271 - (21%)
Similarity:100/271 - (36%) Gaps:72/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VYLHLLLITEAVIGLLILVVTAYY---HTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFL-CS 70
            :|:.||......:||:.:.|.|..   .|::.|........:|. ...|:::|    :|.|: |.
Human    14 LYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVI-IAVGVFLF----LVAFVGCC 73

  Fly    71 IAMWRRIWRRRCTPNIRLLLSVWAFYSCVII----ASGFGCVWNLYRGVDVLENAADTSLTRGID 131
            .|         |..|..|:::...|.|.:::    |:..|.|:.     |.:.:..:.:..:.::
Human    74 GA---------CKENYCLMITFAIFLSLIMLVEVAAAIAGYVFR-----DKVMSEFNNNFRQQME 124

  Fly   132 MYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCDSCFNNF 196
            .|........:.|.:|...:|||...|.||   |.:|....|     ..|.:||......|..||
Human   125 NYPKNNHTASILDRMQADFKCCGAANYTDW---EKIPSMSKN-----RVPDSCCINVTVGCGINF 181

  Fly   197 ----LPSEG--QSIGGNSRQPFPALTVDSINANGCLPAFVSAVWNCFYILMALWVLALKFLIVL- 254
                :..||  :.|||..|:.                          .:::|...|.:.|:.|| 
Human   182 NEKAIHKEGCVEKIGGWLRKN--------------------------VLVVAAAALGIAFVEVLG 220

  Fly   255 ----CCMTKFI 261
                ||:.|.|
Human   221 IVFACCLVKSI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 51/254 (20%)
CD151_like_LEL 112..237 CDD:239408 25/130 (19%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 55/265 (21%)
CD63_LEL 105..203 CDD:239419 26/136 (19%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.