DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and PRPH2

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_000313.2 Gene:PRPH2 / 5961 HGNCID:9942 Length:346 Species:Homo sapiens


Alignment Length:228 Identity:51/228 - (22%)
Similarity:84/228 - (36%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AMWRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYS- 135
            |.|:        |.::..|::...::.::......|.  |.||  .|||.....|..|:..|.. 
Human    92 ARWK--------PWLKPYLAICVLFNIILFLVALCCF--LLRG--SLENTLGQGLKNGMKYYRDT 144

  Fly   136 -----CPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRR-------------ENNCTSMVL--- 179
                 |...|.: |.||...:|||.:|::||...:|:..|             ::|.....|   
Human   145 DTPGRCFMKKTI-DMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDG 208

  Fly   180 APFACCKRSCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSIN--ANGCLPAFVSAVWNCFY--IL 240
            .||:||..|...      |.....|..||.........:.:|  ..||..|.:|     :|  ::
Human   209 VPFSCCNPSSPR------PCIQYQITNNSAHYSYDHQTEELNLWVRGCRAALLS-----YYSSLM 262

  Fly   241 MALWVLALKFLIVLCCMTKFIVHRQNEGDGCDN 273
            .::.|:.|...:....:|..:.:.|...||..|
Human   263 NSMGVVTLLIWLFEVTITIGLRYLQTSLDGVSN 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 46/209 (22%)
CD151_like_LEL 112..237 CDD:239408 37/148 (25%)
PRPH2NP_000313.2 Tetraspannin 20..277 CDD:278750 46/208 (22%)
peripherin_like_LEL 120..262 CDD:239415 39/157 (25%)
Interaction with MREG. /evidence=ECO:0000250 341..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.