DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tspan3

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_062767.3 Gene:Tspan3 / 56434 MGIID:1928098 Length:253 Species:Mus musculus


Alignment Length:269 Identity:62/269 - (23%)
Similarity:93/269 - (34%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SVYLHLLLITEAVIGLLILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAM 73
            :|.:.|.||.....|:| ..|.||.......|  |.....||.....:.:.....::..:..|..
Mouse    11 TVLVFLNLIFWGAAGIL-CYVGAYVFITYDDY--DHFFEDVYTLFPAVVIIAVGALLFIIGLIGC 72

  Fly    74 WRRIWRRRC--TPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSL---------- 126
            ...|...||  ...:.:||.|:. ...|::..|:     :||.  .:||..|.|:          
Mouse    73 CATIRESRCGLATFVFILLLVFV-TEVVVVVLGY-----VYRA--KVENEVDRSIQKVYKTYNGT 129

  Fly   127 -----TRGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCK 186
                 :|.||.             :|....|||:|.|.||.|.:|....:|..     .|.:||:
Mouse   130 NSDAASRAIDY-------------VQRQLHCCGIHNYSDWENTDWFKETKNQS-----VPLSCCR 176

  Fly   187 RSCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVWNCFYILM-----ALWVL 246
            .:..||            .|:...|      ..:.|.||....|..:..   |||     ||...
Mouse   177 ETAKSC------------NGSLANP------SDLYAEGCEALVVKKLQE---ILMHVIWAALAFA 220

  Fly   247 ALKFLIVLC 255
            |::.|.:||
Mouse   221 AIQLLGMLC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 58/258 (22%)
CD151_like_LEL 112..237 CDD:239408 31/139 (22%)
Tspan3NP_062767.3 Tetraspannin 9..232 CDD:395265 62/269 (23%)
TM4SF8_like_LEL 104..210 CDD:239416 33/151 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.