DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and tspan36

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001002748.1 Gene:tspan36 / 437021 ZFINID:ZDB-GENE-040718-248 Length:243 Species:Danio rerio


Alignment Length:284 Identity:63/284 - (22%)
Similarity:97/284 - (34%) Gaps:94/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LITEAVIGLLILVV-------TAYYHT-VLTGY------LSDIECRLVYGYLFGIYVFGAQVVVT 66
            :||...|.||:.::       .||..: |:..|      :||....:....:.|:      .||.
Zfish     5 IITSKTILLLLSLIFWAAGAALAYVGSYVIKSYNNFEDFMSDRHTLIPAAIIIGV------AVVM 63

  Fly    67 FLCSIAMWRRIWRRRCTPNIR--------LLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAAD 123
            |:....        .|...:|        .|:.:...::..:.|..||.:   |||         
Zfish    64 FIIGFV--------GCCATLRESKVGLGLFLIIIMLIFAAEVTAFVFGII---YRG--------- 108

  Fly   124 TSLTRGIDMYYSCPEWKLLWDG----------LQWHKECCGVHGYKDWMNAEWMPRRENNCTSMV 178
              ..|| |:..|..:..|.:||          ||...|||||....||....|..:..|.     
Zfish   109 --RIRG-DLEKSMNDVFLKYDGLNSETHAVDYLQSQLECCGVKNQTDWTLTSWFAQHNNT----- 165

  Fly   179 LAPFACCKRSCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGC---LPAFVSAVWNCFYIL 240
             .|.:|||.:...|            .|...||      |.:|..||   |...:..|.: :.:|
Zfish   166 -VPQSCCKANMTQC------------TGQLSQP------DLLNTQGCEAKLEQVLQDVLS-YAML 210

  Fly   241 MALWVLALKF-----LIVLCCMTK 259
            :.|....:||     :.|:.|.:|
Zfish   211 VILGFAIIKFFGMLSVCVITCKSK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 59/275 (21%)
CD151_like_LEL 112..237 CDD:239408 35/137 (26%)
tspan36NP_001002748.1 TM4SF8_like_LEL 103..206 CDD:239416 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.