DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and tspan33a

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001002617.2 Gene:tspan33a / 436890 ZFINID:ZDB-GENE-040718-361 Length:281 Species:Danio rerio


Alignment Length:239 Identity:55/239 - (23%)
Similarity:93/239 - (38%) Gaps:54/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VIGLLILVVTAY-----YHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAMWRRIWRR 80
            :|.|:::.:..|     :.|.|.....|....|:   :.||.:|    .:||...:...|.    
Zfish    34 IISLVLISIGVYSRIVKHETALACLTVDPALILM---VVGILMF----FITFCGCVGSLRE---- 87

  Fly    81 RCTPNIRLLLSVWAFYSCV----IIASGFGCVW-NLYRG--VDVLENAADTSLTRGIDMYYSCPE 138
                ||.||.:...|.:.:    ::|...|.|: :..||  .|:.:||        |..|....:
Zfish    88 ----NICLLQTFCIFLTIMFLLQLLAGVLGFVFSDKARGKVTDMFDNA--------IKHYRDDLD 140

  Fly   139 WKLLWDGLQWHKECCGVHGYKDWMNAEWM------PRRENNCTSMVLAPFACCKRSCDSCFNNFL 197
            .:.|.|..|....|||...:.||....:.      |.|| .|:    .||:||..:.:....|  
Zfish   141 LQNLIDYGQKQFNCCGGISFMDWSKNMYFNCSDDNPSRE-RCS----VPFSCCLHAKEETIIN-- 198

  Fly   198 PSEGQSIGGNSRQPFPALTVDS-INANGCLPAFVSAVWNCFYIL 240
                 ::.|:..|....|...: ||.|||:...|:.:.:..::|
Zfish   199 -----TMCGHGMQALNYLAASAFINTNGCIDILVNWIHSNLFLL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 55/239 (23%)
CD151_like_LEL 112..237 CDD:239408 33/133 (25%)
tspan33aNP_001002617.2 Tetraspannin 21..262 CDD:278750 55/239 (23%)
penumbra_like_LEL 114..234 CDD:239411 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.