DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp66E

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:236 Identity:51/236 - (21%)
Similarity:82/236 - (34%) Gaps:88/236 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IYVFGAQVVVTFLCSIAMWRRIWRRRCTPNIRLLLSVWAFYSCV-----IIASGFGCVWNLYRGV 115
            :.|.||  |:.|:..:.....:...||      |||.:..:..:     |:|.|.|..:.     
  Fly    70 LLVIGA--VMFFMSFLGYLGAMRESRC------LLSTYGTFLILLLIAEIVAGGLGAFFK----- 121

  Fly   116 DVL----ENAADTSLTRGIDMYYSCPE----WKLLWDGLQWHKECCGVHGYKD------WMNAEW 166
            |.:    :|...|::|.     ||..|    ..|:|:.|..:..|||::.|.|      |:|.  
  Fly   122 DKVRAESKNFLQTTITS-----YSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNG-- 179

  Fly   167 MPRRENNCTSMVLAPFACC---------KRSCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSINA 222
                :.|.|    .|.|||         .|. :.|..|  ||:.                :|...
  Fly   180 ----KGNRT----IPDACCILKDVAKLVPRD-EDCTTN--PSDS----------------NSFYK 217

  Fly   223 NGCLPAFVSAVWNCFYILMALWVLALKFLIVLCCMTKFIVH 263
            .||...|..            |::..:.|::: .:...|||
  Fly   218 KGCYEVFTE------------WLIRQRELVIV-AIAVGIVH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 48/227 (21%)
CD151_like_LEL 112..237 CDD:239408 32/147 (22%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 51/236 (22%)
uroplakin_I_like_LEL 116..231 CDD:239409 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.