DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and TM4SF

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:297 Identity:58/297 - (19%)
Similarity:96/297 - (32%) Gaps:122/297 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IEC--RLVYGYLFGIYVFGAQVVVTFLCSIAMW----------RRIW------------------ 78
            |:|  .|||.|:..:.:.||..:  ||.:..:|          .::|                  
  Fly     7 IKCFKYLVYSYVVLLALTGAAQI--FLGTSLLWGHSVYYGIVQNKLWAPAAILLCLGPVTFILCW 69

  Fly    79 --------RRRCTPNIRLLLSVWA--FYSCVIIASGFGCVW------NLYRGVDVLENAADTSLT 127
                    |:||      ||.::|  ..:|:.: ....|.|      ||...|::.   .|.|..
  Fly    70 MGCQATNQRKRC------LLGMFAALLVACICV-QFIICGWSLAMRENLPTSVEIF---IDDSFV 124

  Fly   128 RGIDMYYSCPEWKL-LWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKR---- 187
            ..:|.:.......| ||:.:|...:||||.|..|:       ||       :..|::||.|    
  Fly   125 EFLDKFSRTKVDNLHLWNRMQSQLQCCGVDGPLDY-------RR-------LSLPWSCCSRPEHA 175

  Fly   188 ---SCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVWNCFYILM--ALWVLA 247
               :||:.:.                            .|||......:.|...|..  |..:..
  Fly   176 YESACDTHYK----------------------------RGCLAVVSEQIRNRLLITAFGAAIIAI 212

  Fly   248 LKFLIVLCCMTKFIVHRQNEGDGCDNVGLTDDDGHPL 284
            .:.|.:.|.:...|:..:|            |:.||:
  Fly   213 FQSLGIFCAVHLTILFGKN------------DNTHPM 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 52/267 (19%)
CD151_like_LEL 112..237 CDD:239408 26/132 (20%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 52/268 (19%)
uroplakin_I_like_LEL 111..197 CDD:239409 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.