DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp42Er

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:167 Identity:30/167 - (17%)
Similarity:56/167 - (33%) Gaps:57/167 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVYGYLFGIYVFGAQVVVTFLCSIAMWRRIWRRRCTPNIRLLLSVW-AFYSCVIIASGFGCVWNL 111
            |.:.:.|...|.|...:|..:.:|        .:..|..:|:|.:: |..|.|.:.|.|||...:
  Fly    11 LAFLFNFLCAVLGIATIVVNVIAI--------DQIAPKDQLILGLYIAVGSIVFLLSFFGCFGAI 67

  Fly   112 YRGVDV-------------------------LENAADTSLTRGI----DMYYSCPEWKLLWDGLQ 147
            ...:.|                         .|..:.|.|.:..    :.:.:..|:       |
  Fly    68 KESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKLKQAFAKQTNTFDAMAEY-------Q 125

  Fly   148 WHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFAC 184
            ...:|||::..||:.:|            .:..|.:|
  Fly   126 TQYQCCGIYKLKDYGDA------------YITVPSSC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 30/167 (18%)
CD151_like_LEL 112..237 CDD:239408 14/102 (14%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 30/167 (18%)
tetraspanin_LEL 93..174 CDD:239401 13/77 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442996
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.