DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:165 Identity:31/165 - (18%)
Similarity:56/165 - (33%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLITEAVIGLLILVVTAY------YHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAM 73
            |.::..|:..|..|:.|.      |..:...:...|....:.|.:.|..:|.:.:   |.|..|:
  Fly     8 LKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTI---FGCIAAL 69

  Fly    74 WRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYSCPE 138
                     ..:||:   .| .|:.:::|..|..:      ..:|....:..|.....:|.:   
  Fly    70 ---------RESIRM---TW-IYAAILLALVFSQI------TVILAQPINYELLANETIYDA--- 112

  Fly   139 WKLLWDGLQWHKE----------CCGVHG---YKD 160
                |.|..:|.:          |||..|   |.|
  Fly   113 ----WQGQLYHSDRMSYFEIKYHCCGQTGPANYPD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 30/160 (19%)
CD151_like_LEL 112..237 CDD:239408 12/62 (19%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 31/165 (19%)
tetraspanin_LEL 95..173 CDD:239401 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.