DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and lbm

DIOPT Version :10

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523639.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:34 Identity:10/34 - (29%)
Similarity:14/34 - (41%) Gaps:10/34 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EANEA----------EAAEMEFGDMLRQKIPKNF 48
            |||.:          |:|.|:....|..|.|.:|
  Fly   251 EANSSPMFESIDWNLESASMDLKLDLNFKNPNDF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 CD151_like_LEL 112..237 CDD:239408
lbmNP_523639.1 Tetraspanin <47..196 CDD:459767
tetraspanin_LEL <109..169 CDD:239401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.