DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:274 Identity:50/274 - (18%)
Similarity:90/274 - (32%) Gaps:110/274 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ASVYLHLLLITE---AVIGLLIL------VVTAYYHTVLTGYLSDIECRLVYGYL---FGIYVFG 60
            |:...|:||:..   :|:||.::      :::|..:.|..|       :.|.|.|   .|:.:. 
  Fly     5 ATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIG-------KNVAGGLIIALGVVIL- 61

  Fly    61 AQVVVTFLCSIAMWRRIWRRRCTPNIRLLLSVWAFYSCVI--------------------IASGF 105
              ::..|.|..|:..       .| :|||:.|.|....::                    |..||
  Fly    62 --IIAIFGCLAAIHE-------AP-VRLLIYVGAVVLLILAQLIFLGMSSHGTKDGISGSINEGF 116

  Fly   106 GCVWNLYRGVDVLENAADTSLTRGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRR 170
            ..:|.           ::.:.|..:..|.|            | .:||||:..:|:    |:...
  Fly   117 DRLWE-----------SERNQTGALSYYES------------W-LQCCGVNSSEDY----WIIHH 153

  Fly   171 ENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVWN 235
            .        .|.:||..|  .|.:                     |...:...||..|||..:.:
  Fly   154 G--------IPSSCCPES--KCMD---------------------TPSRVFKTGCKAAFVKYLDD 187

  Fly   236 CFYIL-MALWVLAL 248
            ...:. :..|:|.:
  Fly   188 KLLVFKIVCWLLVI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 46/259 (18%)
CD151_like_LEL 112..237 CDD:239408 21/124 (17%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 49/272 (18%)
DUF373 <17..>101 CDD:299895 19/101 (19%)
tetraspanin_LEL 104..189 CDD:239401 25/143 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.