DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:268 Identity:48/268 - (17%)
Similarity:91/268 - (33%) Gaps:103/268 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLITEAVIGLLILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAMWRRIW 78
            |.|....||||.:.::..:.|.....::              |...|..||:|     |::..:.
  Fly    19 LALFGLVVIGLGVHIIYKFEHFNTAAFV--------------IIAVGVVVVLT-----ALFGALG 64

  Fly    79 RRR---CTPNIRLLLSV-------------WAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLT 127
            ..|   .|..:.:::.:             |.|.:.::|        |:.:..|.|.|.....:.
  Fly    65 AARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLI--------NVDKTFDKLWNDQPVPIK 121

  Fly   128 RGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCDSC 192
            .|.....:..|        :| .:|||..|..|:                :|.|        :||
  Fly   122 PGNQSQIASLE--------RW-LDCCGNVGPSDY----------------ILPP--------NSC 153

  Fly   193 FNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAV---WNCFYILMALWVLALKFLIVL 254
            :|      |:|              |.:|..||...|:..:   |..|. |::|.:|.::   ::
  Fly   154 YN------GES--------------DKLNLEGCRQKFLDFIADRWTTFN-LVSLVLLGVE---LI 194

  Fly   255 CCMTKFIV 262
            |.:..:::
  Fly   195 CALLAYVL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 45/254 (18%)
CD151_like_LEL 112..237 CDD:239408 24/127 (19%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 48/266 (18%)
tetraspanin_LEL 95..176 CDD:239401 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.