DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp42Ee

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster


Alignment Length:267 Identity:49/267 - (18%)
Similarity:85/267 - (31%) Gaps:75/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SVYLHLLLITE---AVIGLLILVVTAYYHTVLTGYLSDIECRLVYGY----LFGIYVFGAQVVVT 66
            |:..::|.|..   :|||:|.:|    |..::...:..:|.....|:    |..|.:.....:|.
  Fly     6 SMVKYILFIFNTIVSVIGILGIV----YGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIVV 66

  Fly    67 FLCSIAMWRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGID 131
            |:..:.....|....|      :...:|.:..:::......|..|:...:..|||....:...  
  Fly    67 FISFLGCCGAIRESVC------MTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENA-- 123

  Fly   132 MYYSCPEWKL-------LWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSC 189
                   |..       ::|.:|....|||.....|::.            ...|.|.:||..||
  Fly   124 -------WNSEHTYKGGVFDTIQKSLHCCGSSSALDYIG------------KGDLVPPSCCSGSC 169

  Fly   190 DSCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVW----NCFYILMALWVLALKF 250
             ....|:.|                         ||...||..:.    |..|:.:.|..:.|..
  Fly   170 -LIPTNYYP-------------------------GCRGKFVELMTTGSDNAKYVGIGLIGIELIG 208

  Fly   251 LIVLCCM 257
            .|..||:
  Fly   209 FIFACCL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 44/250 (18%)
CD151_like_LEL 112..237 CDD:239408 23/135 (17%)
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 48/265 (18%)
tetraspanin_LEL 106..187 CDD:239401 22/127 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.