DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and TSPAN33

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_848657.1 Gene:TSPAN33 / 340348 HGNCID:28743 Length:283 Species:Homo sapiens


Alignment Length:231 Identity:53/231 - (22%)
Similarity:84/231 - (36%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAMWRRIWRRRCTPNIRLL 89
            :::|....|..::....:.:.|..|...:..|.|.....::||...|...|.        ||.||
Human    38 MVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLMFLLTFCGCIGSLRE--------NICLL 94

  Fly    90 ----LSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYSCPEWKLLWDGLQWHK 150
                |.:.|.:...:.|...|.|::     |.........:...|..|....:.:.|.|..|...
Human    95 QTFSLCLTAVFLLQLAAGILGFVFS-----DKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKF 154

  Fly   151 ECCGVHGYKDWMN------AEWMPRRENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSI----G 205
            .|||...||||..      :|..|.|| .|:    .|::||           ||:..|::    .
Human   155 SCCGGISYKDWSQNMYFNCSEDNPSRE-RCS----VPYSCC-----------LPTPDQAVINTMC 203

  Fly   206 GNSRQPFPALTVDS-INANGCLPAFVSAVWNCFYIL 240
            |...|.|..|.... |..|||:...|:.:.:..::|
Human   204 GQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 53/231 (23%)
CD151_like_LEL 112..237 CDD:239408 33/135 (24%)
TSPAN33NP_848657.1 penumbra_like_LEL 116..236 CDD:239411 34/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.