DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tsp5D

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:89/229 - (38%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQPFRRASVYLHLLLITEAVIGLLILVVTAYYHTVL---TGYLSDIECRLVYGYLFGIYVFGAQ 62
            :|:.|...::.|.|........||.:.:..|.|.|:|   .|..:|.        :| :.:.|..
  Fly     9 IRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADT--------IF-MGIGGTG 64

  Fly    63 VVVTFLCSIAMWRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLT 127
            .||:|......|   .:.||...:..:|.|..|.|..::    |.:..|:||  .|.......|.
  Fly    65 FVVSFFGCCGAW---VQSRCLLVLYFMLIVMLFMSEFLV----GSIAFLFRG--GLGRTLANELR 120

  Fly   128 RGIDMYYS--------CPEWKLLWDGLQWHKECCGVHGYKDWMNAE-WMPRRENNCTSMVLAPFA 183
            .||:.:|:        .|....:||.:|...|||||..|:||.:.: |..||        ..|.:
  Fly   121 FGIERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRR--------WVPES 177

  Fly   184 CCKRSCDSCFNNFLPSEGQSIG------GNSRQP 211
            ||:...|   ...:.:||...|      |.|..|
  Fly   178 CCRTLYD---QRQVLTEGSGDGMMRPDCGRSENP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 54/210 (26%)
CD151_like_LEL 112..237 CDD:239408 32/115 (28%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 58/229 (25%)
NET-5_like_LEL 105..228 CDD:239418 33/117 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.