DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Tspan17

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_006253692.1 Gene:Tspan17 / 306771 RGDID:1311167 Length:281 Species:Rattus norvegicus


Alignment Length:268 Identity:60/268 - (22%)
Similarity:95/268 - (35%) Gaps:84/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YLFG----IYVFGAQVVVTFLCSIAMWRRIW-RRRCTPNIRLLLS------VWAFYSCVIIAS-- 103
            :|||    .:|.||    .|| :|.:|  .| .:....||..|..      ||.|   |:|..  
  Rat    20 FLFGFNIVFWVLGA----LFL-AIGLW--AWGEKGVLSNISGLTDLGGLDPVWLF---VVIGGIM 74

  Fly   104 ---GF-GCV------------WNLYRGV----------------DVLENAADTSLTRGIDMYYSC 136
               || ||:            ::::.|:                |.:.:..:..:...:..|...
  Rat    75 SVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDWIRDQLNLFINNNVKAYRDD 139

  Fly   137 PEWKLLWDGLQWHKECCGVHGYKDW-MNAEWMPRRENNCTSM------VLAPFACCKRSCDSCFN 194
            .:.:.|.|..|.:..|||..|..|| :|..:      |||.:      ...||:||.|.      
  Rat   140 IDLQNLIDFAQEYWSCCGARGPNDWNLNIYF------NCTDLNPSRERCGVPFSCCVRD------ 192

  Fly   195 NFLPSE---GQSIGGNSRQPFPALTVDSINANGCLPAFVSAVWNCFYILMALWVLALKFLIVLC- 255
               |:|   ....|.:.|.........||...||:..|..  |....:::...||....|:.:| 
  Rat   193 ---PAEDVLNTQCGYDIRLKLELEQQGSIYTKGCVGQFEK--WLQDNLIVVAGVLVAIALLQICG 252

  Fly   256 -CMTKFIV 262
             |:.:.:|
  Rat   253 ICLAQNLV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 58/260 (22%)
CD151_like_LEL 112..237 CDD:239408 31/150 (21%)
Tspan17XP_006253692.1 TM4SF9_like_LEL 115..235 CDD:239412 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.