DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and Cd63

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:274 Identity:59/274 - (21%)
Similarity:100/274 - (36%) Gaps:78/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VYLHLLLITEAVIGLL-------ILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTF 67
            :|:.||......:||:       :::..|..|....|.|..:....|..:||         :|.|
  Rat    38 LYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLF---------LVAF 93

  Fly    68 L-CSIAMWRRIWRRRCTPNIRLLLSVWAFYSCVIIA------SGFGCVWNLYRGVDVLENAADTS 125
            : |..|         |..|..|:::...|.|.:::.      :|:     ::|  |.:::....|
  Rat    94 VGCCGA---------CKENYCLMITFAIFLSLIMLVEVAVAIAGY-----VFR--DQVKSEFSKS 142

  Fly   126 LTRGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCD 190
            ..:.:..|.:..:...:.|.||...:|||...|.||.....|.:..        .|.:||.....
  Rat   143 FQKQMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDR--------VPDSCCINITV 199

  Fly   191 SCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVW---NCFYILMALWVLALKFLI 252
            .|.|:|..|                   :|:..||:...  |.|   |  .:|:|...|.:.|:.
  Rat   200 GCGNDFKES-------------------TIHTQGCVETI--AAWLRKN--VLLVAGAALGIAFVE 241

  Fly   253 VL-----CCMTKFI 261
            ||     ||:.|.|
  Rat   242 VLGIIFSCCLVKSI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 52/257 (20%)
CD151_like_LEL 112..237 CDD:239408 27/127 (21%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 58/272 (21%)
ATP-synt_A <72..131 CDD:294288 15/81 (19%)
CD63_LEL 129..227 CDD:239419 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.