DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and tsp-12

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_501853.1 Gene:tsp-12 / 177890 WormBaseID:WBGene00006638 Length:308 Species:Caenorhabditis elegans


Alignment Length:265 Identity:63/265 - (23%)
Similarity:98/265 - (36%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SDIECRLVYGYL----------FGIYVFG--AQV------------------------VVTFLCS 70
            |:|.|.:.|...          ||:.:||  ||:                        :|.||..
 Worm    32 SEISCCVKYSVFSFNVIFFLLGFGLLLFGVWAQIEKNTFVNMLSKASKLYLDPTWPLLIVGFLTF 96

  Fly    71 IAMWRRIWRRRCTPNIRLLLSVWAFYSC---VIIASGFGCVWNLYRGVDVLENAADTSLTRGIDM 132
            |     |....|..::|...|...|||.   :::.:.|......|...|.|:|.....|...:..
 Worm    97 I-----IGFSGCVGSLRENTSFLTFYSTLLGLLLIAEFSAGVFAYACRDQLDNYIRNLLNDVVVG 156

  Fly   133 YYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEW--MPRRENNCTSMVLAPFACCKRSCDSCFNN 195
            |...|:.:||.|.:|....|||::|..||....:  :..||.........||:||..|....|.|
 Worm   157 YRDDPDLQLLIDSMQETWMCCGINGADDWDRNTYFSIEAREVASPEAGGVPFSCCINSSKLEFKN 221

  Fly   196 FLPSEGQSIGGNSR-------QPFPALTVDSINANGCLPAFVSAVW---NCFYILMALWVLALKF 250
            :....|..:...|.       |...|.|. ||...||||..  .:|   |...:.:::.::|:..
 Worm   222 YFCGHGVRLKPESHMAAHLAAQRVMAHTA-SIYTEGCLPKL--QLWLNNNMLLVAVSMVIIAIIQ 283

  Fly   251 LIVLC 255
            ::.:|
 Worm   284 VLGIC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 63/265 (24%)
CD151_like_LEL 112..237 CDD:239408 39/136 (29%)
tsp-12NP_501853.1 Tetraspannin 38..293 CDD:306775 60/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.