DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and TSPAN3

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_005715.1 Gene:TSPAN3 / 10099 HGNCID:17752 Length:253 Species:Homo sapiens


Alignment Length:258 Identity:57/258 - (22%)
Similarity:93/258 - (36%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SVYLHLLLITEAVIGLLILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAM 73
            :|.:.|.||.....|:| ..|.||.......|  |.....||..:..:.:.....::..:..|..
Human    11 TVLVFLNLIFWGAAGIL-CYVGAYVFITYDDY--DHFFEDVYTLIPAVVIIAVGALLFIIGLIGC 72

  Fly    74 WRRIWRRRCTPNIRLLLSVWAFYS-CVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYSC- 136
            ...|...||.....:::.:..|.: .|::..|:     :||.  .:||..|.|:.:....|... 
Human    73 CATIRESRCGLATFVIILLLVFVTEVVVVVLGY-----VYRA--KVENEVDRSIQKVYKTYNGTN 130

  Fly   137 PE-WKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCDSCFNNFLPSE 200
            |: .....|.:|....|||:|.|.||.|.:|....:|..     .|.:||:.:..:|        
Human   131 PDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQS-----VPLSCCRETASNC-------- 182

  Fly   201 GQSIGGNSRQPFPALTVDSINANGCLPAFVS--------AVWNCFYILMALWVLALKFLIVLC 255
                .|:...|      ..:.|.||....|.        .:|      .||...|::.|.:||
Human   183 ----NGSLAHP------SDLYAEGCEALVVKKLQEIMMHVIW------AALAFAAIQLLGMLC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 53/247 (21%)
CD151_like_LEL 112..237 CDD:239408 31/134 (23%)
TSPAN3NP_005715.1 Tetraspannin 9..232 CDD:395265 57/258 (22%)
TM4SF8_like_LEL 104..210 CDD:239416 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.