DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp33B and tspan15

DIOPT Version :9

Sequence 1:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001017773.1 Gene:tspan15 / 100000710 ZFINID:ZDB-GENE-050417-295 Length:296 Species:Danio rerio


Alignment Length:277 Identity:60/277 - (21%)
Similarity:107/277 - (38%) Gaps:87/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YLHLLLITEA----VIGLLILVVTAY-------YHTVLTGYLSDIECRLVYGYLFGIYVFGAQVV 64
            :|...||..|    :||..||.:..|       |.|:...:|:.....:|    .||.:|    :
Zfish    15 FLKFSLIGYATIFWLIGGFILAIGIYAEVERQRYKTLEGVFLAPAIILIV----LGIIMF----I 71

  Fly    65 VTFLCSIAMWRRIWRRRCTPNIRLL-LSVWAFYSCVIIASGFGCVWNLYRG--VDVLENAADTSL 126
            |:|:..:|..|        .|:.|| :.::....|:::....|.|..:::.  ||:|    :.::
Zfish    72 VSFIGVLASLR--------DNLCLLKVFLYMLALCLVLELVGGIVALIFKNQTVDIL----NKNI 124

  Fly   127 TRGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDW-MNAEWMPRRENNCTS----MVLAPFACCK 186
            .:|:..||...::|.:.|.:|...:|||...|:|| :|      ..:||::    ...||:.|| 
Zfish   125 RKGMVNYYDDLDFKNIMDFVQKTFKCCGGTEYQDWEVN------MYHNCSAPGPLACAAPYTCC- 182

  Fly   187 RSCDSCFNNFLPSEGQSIGGNSRQPFPAL------TVDSINANGC-------------------- 225
                      :.:.|:.:  |:...:..|      ..|.|...||                    
Zfish   183 ----------IVTPGEVV--NTMCGYKTLNKDRHENTDVIYIRGCTDAVFIWLIDNYKTMAGLLL 235

  Fly   226 ---LPAFVSAVWNCFYI 239
               ||.|...::...||
Zfish   236 GIFLPQFFGVIFTWLYI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 57/268 (21%)
CD151_like_LEL 112..237 CDD:239408 32/160 (20%)
tspan15NP_001017773.1 Tetraspannin 16..252 CDD:278750 58/274 (21%)
MgtE <54..>113 CDD:280023 15/74 (20%)
penumbra_like_LEL 110..227 CDD:239411 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.