DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and LRRC3

DIOPT Version :9

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_112153.1 Gene:LRRC3 / 81543 HGNCID:14965 Length:257 Species:Homo sapiens


Alignment Length:172 Identity:53/172 - (30%)
Similarity:74/172 - (43%) Gaps:21/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLALLAITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQSERFLR 74
            ||..|.:.||| |:.|.|....|...|.|..:.|..:||.:...|.:|....|.:..|....|  
Human    23 LLFCLHLGAAC-PQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAF-- 84

  Fly    75 MDLLNLQKIYLSRNQLIRIHEKAFRGLT-NLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPI 138
            ..|..|:::.||.|.:..|....|.||. .|..||||.|.:|.:|.:.....|:.:|  ||.||:
Human    85 QHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIR--LSHNPL 147

  Fly   139 R---ELKTSAFRHLSFLTTLELSNCQVERIE-----NEAFVG 172
            .   .|:.:       |..|:|....|:.|.     .|.|||
Human   148 HCECALQEA-------LWELKLDPDSVDEIACHTSVQEEFVG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 5/17 (29%)
leucine-rich repeat 54..79 CDD:275380 6/24 (25%)
LRR_8 79..138 CDD:290566 21/59 (36%)
LRR_RI <80..187 CDD:238064 32/102 (31%)
leucine-rich repeat 80..103 CDD:275380 8/23 (35%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
LRR_8 126..186 CDD:290566 16/55 (29%)
leucine-rich repeat 128..151 CDD:275380 6/25 (24%)
leucine-rich repeat 152..175 CDD:275380 9/26 (35%)
leucine-rich repeat 176..198 CDD:275380
TPKR_C2 207..256 CDD:301599
I-set 258..361 CDD:254352
Ig_2 263..361 CDD:290606
LRRC3NP_112153.1 LRRNT 32..68 CDD:214470 12/36 (33%)
leucine-rich repeat 48..65 CDD:275378 5/16 (31%)
LRR 1 65..86 5/22 (23%)
leucine-rich repeat 66..89 CDD:275378 6/24 (25%)
LRR_8 69..125 CDD:290566 19/57 (33%)
LRR_4 69..103 CDD:289563 9/35 (26%)
LRR_4 89..129 CDD:289563 15/39 (38%)
LRR 2 89..110 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
LRR 3 114..135 8/20 (40%)
leucine-rich repeat 115..138 CDD:275378 8/22 (36%)
LRR 4 136..157 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.