DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek2 and LRFN3

DIOPT Version :10

Sequence 1:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_078785.1 Gene:LRFN3 / 79414 HGNCID:28370 Length:628 Species:Homo sapiens


Alignment Length:432 Identity:110/432 - (25%)
Similarity:171/432 - (39%) Gaps:85/432 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGLPIWIPLLALLAIT-AACPPEV---------CVCKWKGGKQTVECGGQQLSNLPEGMD---- 51
            |:.||:   ||.||.:. |:.||:.         |.|:.:....:|.|.|..|..:|..:|    
Human     1 MAILPL---LLCLLPLAPASSPPQSATPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRRAA 62

  Fly    52 --------------------PGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEK 96
                                .|...|:.|.|.::.:.:..|  .||..|:.::|..|:|..:.|.
Human    63 ELRLADNFIASVRRRDLANMTGLLHLSLSRNTIRHVAAGAF--ADLRALRALHLDGNRLTSLGEG 125

  Fly    97 AFRGLTNLVELDLSENALQNVPSETFQDYS-SLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNC 160
            ..|||.||..|.||.|.|..:.:....|.: :|..|.||.|.:.:|...|...|..:.||.|.:.
Human   126 QLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLGNVNTLGLDHN 190

  Fly   161 QVERIENEAFVGMDNLEWLRLDGNRIGFIQGTHIL------------PKSLHGISLHSNRWNCDC 213
            .:..:...||..:..|..|.:..||:..|....:.            |.|...::...|..:|:|
Human   191 LLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPASALVLAFGGNPLHCNC 255

  Fly   214 RLLDIHFWLVNYNTPLAEE---PKCMEPARLKGQVIKSLQREQLACLPE-VSPQSSYTEVSEGRN 274
            .|:    ||    ..||.|   ..|..|..|.|:...::..|:..|.|. |:.:|....|..||.
Human   256 ELV----WL----RRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTHRSPPLAVPAGRP 312

  Fly   275 MSITCLVRAIPEPKVLWLF-NGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAED 338
            .::.|.....|||:|.|:. .|:::.|.|     ....:.:.|:          |:.:...|  |
Human   313 AALRCRAVGDPEPRVRWVSPQGRLLGNSS-----RARAFPNGTL----------ELLVTEPG--D 360

  Fly   339 NGTFSCVGQNIAGTTFSNYTLRVIIKEPP-VVNEVSF--PRD 377
            .|.|:|:..|.||...:...|.|....|| :.|..|.  |||
Human   361 GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek2NP_523551.1 LRR <34..>204 CDD:443914 49/206 (24%)
leucine-rich repeat 34..52 CDD:275380 6/41 (15%)
leucine-rich repeat 54..79 CDD:275380 6/24 (25%)
leucine-rich repeat 80..103 CDD:275380 8/22 (36%)
leucine-rich repeat 104..127 CDD:275380 7/23 (30%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..175 CDD:275380 5/22 (23%)
leucine-rich repeat 176..198 CDD:275380 6/33 (18%)
LRRCT 207..256 CDD:214507 14/51 (27%)
Ig_3 258..348 CDD:464046 22/91 (24%)
LRFN3NP_078785.1 LRR 1 60..83 0/22 (0%)
LRR <63..>228 CDD:443914 41/166 (25%)
leucine-rich repeat 63..84 CDD:275380 0/20 (0%)
LRR 2 84..105 5/22 (23%)
leucine-rich repeat 85..108 CDD:275380 6/24 (25%)
LRR 3 108..129 5/20 (25%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR 4 132..153 7/20 (35%)
leucine-rich repeat 133..157 CDD:275380 7/23 (30%)
LRR 5 157..178 7/20 (35%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
LRR 6 181..202 5/20 (25%)
leucine-rich repeat 182..205 CDD:275380 5/22 (23%)
LRR 7 205..226 5/20 (25%)
leucine-rich repeat 206..230 CDD:275380 5/23 (22%)
leucine-rich repeat 242..253 CDD:275378 1/10 (10%)
LRRCT 249..>281 CDD:214507 12/39 (31%)
Ig 296..383 CDD:472250 25/103 (24%)
Ig strand B 313..317 CDD:409353 0/3 (0%)
Ig strand C 326..330 CDD:409353 1/3 (33%)
Ig strand E 349..353 CDD:409353 1/13 (8%)
Ig strand F 363..368 CDD:409353 2/4 (50%)
Ig strand G 376..379 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..430 8/21 (38%)
fn3 424..502 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.