| Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_083253.1 | Gene: | Lrrc17 / 74511 | MGIID: | 1921761 | Length: | 443 | Species: | Mus musculus |
| Alignment Length: | 251 | Identity: | 64/251 - (25%) |
|---|---|---|---|
| Similarity: | 91/251 - (36%) | Gaps: | 93/251 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 QTVECGGQQLSNLPEGMDPGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAF 98
Fly 99 RGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVE 163
Fly 164 RIENEAFVGMDNLEWLRLDGNRIGFIQGTHILPKSLHGISLHSNRWNCDCRLLDIHFWL-----V 223
Fly 224 NYNTPLAEEPKCMEPARLK----GQVIKSLQRE----QLACLPEVSPQSSYTEVSE 271 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 5/17 (29%) |
| leucine-rich repeat | 54..79 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 79..138 | CDD:290566 | 23/58 (40%) | ||
| LRR_RI | <80..187 | CDD:238064 | 30/106 (28%) | ||
| leucine-rich repeat | 80..103 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 104..127 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 126..186 | CDD:290566 | 8/59 (14%) | ||
| leucine-rich repeat | 128..151 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 152..175 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 176..198 | CDD:275380 | 3/21 (14%) | ||
| TPKR_C2 | 207..256 | CDD:301599 | 16/61 (26%) | ||
| I-set | 258..361 | CDD:254352 | 6/14 (43%) | ||
| Ig_2 | 263..361 | CDD:290606 | 4/9 (44%) | ||
| Lrrc17 | NP_083253.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..48 | ||
| leucine-rich repeat | 65..83 | CDD:275380 | |||
| LRR 1 | 84..105 | ||||
| leucine-rich repeat | 85..108 | CDD:275380 | |||
| LRR_8 | 86..143 | CDD:290566 | |||
| LRR_4 | 107..148 | CDD:289563 | |||
| LRR 2 | 108..129 | ||||
| leucine-rich repeat | 109..132 | CDD:275380 | |||
| LRR 3 | 132..153 | ||||
| leucine-rich repeat | 133..156 | CDD:275380 | |||
| leucine-rich repeat | 157..207 | CDD:275380 | |||
| TPKR_C2 | 165..>201 | CDD:301599 | |||
| leucine-rich repeat | 208..245 | CDD:275380 | |||
| leucine-rich repeat | 251..271 | CDD:275380 | 5/18 (28%) | ||
| LRR_RI | <270..352 | CDD:238064 | 37/154 (24%) | ||
| LRR 4 | 271..292 | 5/22 (23%) | |||
| leucine-rich repeat | 272..295 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 274..330 | CDD:290566 | 23/57 (40%) | ||
| LRR 5 | 295..316 | 8/20 (40%) | |||
| LRR_4 | 296..334 | CDD:289563 | 20/43 (47%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 10/22 (45%) | ||
| LRR 6 | 319..342 | 13/46 (28%) | |||
| leucine-rich repeat | 320..343 | CDD:275380 | 14/46 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||