| Sequence 1: | NP_523551.1 | Gene: | kek2 / 34582 | FlyBaseID: | FBgn0015400 | Length: | 894 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_075358.1 | Gene: | Rtn4r / 65079 | MGIID: | 2136886 | Length: | 473 | Species: | Mus musculus |
| Alignment Length: | 353 | Identity: | 96/353 - (27%) |
|---|---|---|---|
| Similarity: | 132/353 - (37%) | Gaps: | 85/353 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 SGLPIWIPLLALLAITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQV 66
Fly 67 LQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENA------------------ 113
Fly 114 -------------------------------LQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFR 147
Fly 148 HLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNRIGFIQGTHILP-KSLHGISLHSNRWNC 211
Fly 212 DCRLLDIHFWLVNYNTPLAEEPKCMEPARLKGQVIKSL------------------QREQL---- 254
Fly 255 ------ACLPEVSPQSSYTEVSEGRNMS 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek2 | NP_523551.1 | leucine-rich repeat | 34..52 | CDD:275380 | 6/17 (35%) |
| leucine-rich repeat | 54..79 | CDD:275380 | 4/24 (17%) | ||
| LRR_8 | 79..138 | CDD:290566 | 30/107 (28%) | ||
| LRR_RI | <80..187 | CDD:238064 | 45/155 (29%) | ||
| leucine-rich repeat | 80..103 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 104..127 | CDD:275380 | 13/71 (18%) | ||
| LRR_8 | 126..186 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 128..151 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 152..175 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 176..198 | CDD:275380 | 5/22 (23%) | ||
| TPKR_C2 | 207..256 | CDD:301599 | 19/76 (25%) | ||
| I-set | 258..361 | CDD:254352 | 6/19 (32%) | ||
| Ig_2 | 263..361 | CDD:290606 | 5/14 (36%) | ||
| Rtn4r | NP_075358.1 | LRR 1 | 58..79 | 4/22 (18%) | |
| LRR_8 | 60..115 | CDD:290566 | 21/56 (38%) | ||
| leucine-rich repeat | 60..82 | CDD:275380 | 4/23 (17%) | ||
| LRR 2 | 82..103 | 9/20 (45%) | |||
| leucine-rich repeat | 83..106 | CDD:275380 | 10/22 (45%) | ||
| LRR_RI | <90..>166 | CDD:238064 | 16/75 (21%) | ||
| LRR 3 | 106..128 | 7/21 (33%) | |||
| leucine-rich repeat | 107..131 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 131..190 | CDD:290566 | 11/58 (19%) | ||
| LRR 4 | 131..152 | 0/20 (0%) | |||
| leucine-rich repeat | 132..155 | CDD:275380 | 0/22 (0%) | ||
| LRR 5 | 155..176 | 5/20 (25%) | |||
| LRR_4 | 156..195 | CDD:289563 | 12/38 (32%) | ||
| leucine-rich repeat | 156..179 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 179..238 | CDD:290566 | 21/58 (36%) | ||
| LRR 6 | 179..200 | 8/20 (40%) | |||
| leucine-rich repeat | 180..203 | CDD:275380 | 10/22 (45%) | ||
| LRR 7 | 203..224 | 7/20 (35%) | |||
| leucine-rich repeat | 204..227 | CDD:275380 | 7/22 (32%) | ||
| LRR 8 | 227..248 | 4/20 (20%) | |||
| leucine-rich repeat | 228..251 | CDD:275380 | 5/22 (23%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 346..446 | 4/11 (36%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||